SecReT6
Protein ID: 440230383
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1693
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1788720..1790474 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDL0MH40
KEGG IDsmaf:D781_1693
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-182, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|440230383|ref|YP_007344176.1| type VI secretion protein, VC_A0110 family [Serratia marcescens FGI94]
MDDLTLRYYDAEMRYLLEAGEEFAQAHPERAAMLGLDRAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSMSIVEFTPEWREMKEKMGIAKGFEVLSRPIGEKGTRCRYTTTQDLSLQPLS
LAKATLTTDRDGRSLVRLRFDCSSLADWSRIDLACLPLYLNADAPLACAMHQAFTMNVAGMRLRLPGESD
SRPLAGHFTALGFGDDDTLWPTGNSSFSGYQLLLEYFTFREKFMFTGLKGLDAVAFPAQLAWFEIEVVLA
ERWEHDFTFTEKHLRLHCVPVINLFPLESDPLTLDSLQTEYLLRPMRVQDGHTEIYSVDAVVSSGNHTYV
PFASFRHKGGMLRHEAPEYYYHTRVRRGPSGLYNTWLILGGEAFDNHTVPANESLSLALTGTNGQLPRRA
LQSTVLDTLMKTTAASVRVRNLCAPTQPCYPPDRDRFHWRVLSHLGSNFLSMMDNAEVLRGTLALYEWSD
SEMNRRRLEAIVDVRHGETERFEQGHLLRGVQIEVTLDSRGFAGHGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHNRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1788720-1790474 Serratia marcescens FGI94, complete genome
ATGGATGATTTAACCCTGCGTTATTACGACGCTGAAATGCGCTACCTGCTGGAGGCCGGCGAAGAGTTTG
CCCAGGCCCACCCCGAACGCGCGGCGATGCTTGGCCTGGACCGGGCGGGCGCGCGCGACCCTTACGTCGA
GCGCCTGTTTGAGGGCTTTGCCTTTTTGATGGGGCGTCTGCGCGAGAAGCTGGATGACGACCTGCCGGAG
CTGACCGAGGGGCTGGTCAGCCTGCTGTGGCCGCATTATCTGCGCACTATCCCGTCGATGTCGATAGTGG
AGTTCACCCCGGAATGGCGGGAAATGAAAGAGAAGATGGGCATTGCCAAAGGCTTTGAGGTGCTCTCCCG
GCCGATTGGCGAAAAGGGCACGCGCTGTCGCTACACCACCACGCAGGATCTCAGCCTGCAGCCGCTGTCG
CTGGCAAAGGCAACGCTGACCACGGATCGGGATGGCCGTTCGCTGGTGCGGCTGCGCTTTGACTGCAGCA
GTCTGGCGGACTGGAGCCGTATCGATCTCGCTTGCCTCCCGCTCTACCTGAACGCCGACGCGCCGCTGGC
CTGCGCCATGCATCAGGCTTTCACCATGAATGTCGCCGGCATGCGGCTGCGTCTGCCGGGGGAGAGCGAC
AGCCGGCCGCTGGCGGGGCACTTTACGGCGCTGGGCTTTGGCGATGATGACACCCTGTGGCCGACGGGCA
ACAGCAGCTTCAGCGGCTATCAGCTGCTGCTGGAGTATTTTACCTTCCGTGAGAAGTTTATGTTCACCGG
CCTGAAGGGGCTGGACGCCGTGGCGTTTCCGGCACAGCTGGCGTGGTTCGAGATCGAGGTGGTGCTGGCT
GAGCGCTGGGAACACGATTTTACCTTTACGGAAAAGCACCTGCGGTTGCATTGCGTGCCGGTGATCAACC
TGTTCCCGCTGGAGTCCGATCCGCTGACGCTCGATTCGCTGCAGACCGAATATCTGCTGCGGCCGATGCG
GGTGCAGGACGGCCATACTGAAATTTATTCGGTGGATGCGGTGGTGTCGTCCGGCAACCATACCTATGTG
CCGTTTGCCAGCTTTCGCCATAAGGGCGGCATGCTGCGCCATGAGGCGCCGGAATACTATTACCACACCC
GGGTGCGCCGGGGGCCGTCCGGGTTGTATAACACCTGGCTGATTCTGGGCGGCGAGGCGTTTGATAACCA
TACGGTGCCGGCCAATGAGAGCCTGTCGCTGGCGCTTACCGGCACCAACGGCCAGCTGCCGCGGCGCGCG
CTGCAGAGCACGGTGCTGGATACGTTGATGAAAACCACCGCGGCCAGCGTTCGGGTGCGTAACCTTTGTG
CGCCGACGCAGCCCTGTTACCCGCCGGATCGGGACCGCTTTCACTGGCGGGTGCTGAGCCATCTGGGCAG
CAACTTCCTGTCGATGATGGATAACGCCGAGGTGCTGCGCGGCACCCTGGCGCTGTATGAGTGGAGCGAC
AGCGAGATGAACCGCCGCCGGCTGGAGGCGATTGTCGATGTGCGCCACGGCGAAACGGAGCGTTTTGAGC
AGGGGCACCTGCTGCGGGGCGTACAGATTGAGGTCACGCTCGACAGCCGGGGCTTTGCCGGCCACGGAGA
TATCTGCCTGTTCGGTGAAATGCTGAGCCGCTTTTTTGCCCTTTATACCGATATCTATCTGTTTAACCGC
CTGATCATCATCCTGCAACCGACCGGAGAACGTCTGGAATGGGAAGAGAAACACAACCGCCGTATTCCCG
GCTGA