SecReT6
Protein ID: 440230384
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1694
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1790438..1791523 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDL0MFD0
KEGG IDsmaf:D781_1694
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-79, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|440230384|ref|YP_007344177.1| type VI secretion protein, VC_A0111 family [Serratia marcescens FGI94]
MGRETQPPYSRLTPRLEAELTRINFYRFCQLLEKRHPQRPPLGATSKPGDDPLRLVPHPGMGFPASELKA
VEYNEEDAHASPKVRTTFMGLYGVDSPLPTVYLDDIAQRREGHEALQGFLDIFNHRILTQFYRIWRKYSY
PATFESGGGDAISQSLLGLVGLGIPGTANHIATPVSRFLALLGVLRLPGKTAQGLQALVQLLAPHTSVRV
SPYCLRAVAAGRPLGFVDDEDFLLDGNQVLGEEAMDTSSQLLIELATDCEREVRGWMPDGRLYQDFLVML
RVYLGWRFKARIRLTVTTGLLAAPALGDAPLWLGMNGVLGAEEGASAADIPQTFTTELGCYSGLQPAVTR
QGNRRVAYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1790438-1791523 Serratia marcescens FGI94, complete genome
ATGGGAAGAGAAACACAACCGCCGTATTCCCGGCTGACGCCGCGTCTGGAAGCCGAGCTGACGCGAATCA
ACTTTTACCGCTTCTGCCAGCTGCTGGAAAAGCGCCACCCGCAGCGTCCGCCGCTGGGGGCGACCAGCAA
ACCGGGCGATGACCCGCTGCGGCTGGTGCCCCATCCGGGCATGGGCTTCCCGGCCAGCGAGCTGAAGGCC
GTTGAATATAACGAAGAGGACGCGCATGCGTCGCCGAAGGTGCGCACGACCTTTATGGGGCTGTACGGCG
TTGATTCACCGCTGCCGACCGTTTATCTGGATGATATTGCGCAGCGCAGGGAGGGGCACGAGGCGCTGCA
GGGGTTTCTTGATATTTTCAACCACCGCATCCTGACCCAGTTTTACCGCATCTGGCGCAAATACTCCTAC
CCGGCCACCTTTGAGTCCGGCGGCGGCGACGCCATTTCTCAGTCGTTGCTGGGGCTGGTGGGGCTGGGGA
TCCCGGGTACGGCAAACCATATCGCCACCCCGGTTTCGCGCTTTCTGGCGCTGCTGGGCGTGCTGCGTCT
GCCAGGAAAAACCGCGCAAGGGCTGCAGGCGCTGGTGCAGCTGCTGGCGCCGCACACGAGCGTGCGCGTC
AGCCCGTATTGCCTGCGGGCGGTGGCGGCCGGCCGGCCGCTCGGGTTTGTGGATGATGAGGATTTTTTGC
TGGACGGTAATCAGGTGCTGGGGGAAGAAGCGATGGATACCAGCAGCCAGTTGCTGATTGAGCTGGCCAC
CGACTGCGAACGAGAAGTCCGGGGCTGGATGCCGGACGGCCGGCTTTATCAGGATTTTTTGGTGATGCTG
CGGGTTTATCTGGGCTGGCGCTTTAAGGCCCGCATCCGCCTTACCGTCACGACCGGGCTACTGGCAGCGC
CGGCGCTGGGCGACGCGCCGCTCTGGCTGGGAATGAATGGCGTGCTCGGCGCAGAGGAGGGCGCGTCCGC
TGCCGATATCCCCCAAACTTTTACCACGGAGCTTGGCTGTTACAGCGGCCTGCAGCCGGCAGTCACGAGA
CAAGGAAACCGACGTGTTGCGTACAAATTTGACTAA