SecReT6
Protein ID: 440230385
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1695
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1791501..1792043 [+]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDL0MDQ2
KEGG IDsmaf:D781_1695
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-34, Aligned region: 19..172
Protein Sequence: 180 a.a.     [Download]
>gi|440230385|ref|YP_007344178.1| type VI secretion lipoprotein, VC_A0113 family [Serratia marcescens FGI94]
MLRTNLTKTALLLLPVMAFALTGCGLTQSVADGAKSTVRAAFYKKIKVLHLDFVAREMLNTDARESSSAS
QPLVIRIYQLRDRKAFDTLVYQQLLKEDETLLTGDLLASRDVVLKPGNAAILDMPMDAEAKFVAAVGLFR
QPEMEKNSWRLVVAREALNPDTVRVIEADGNSLTLLPERE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1791501-1792043 Serratia marcescens FGI94, complete genome
GTGTTGCGTACAAATTTGACTAAAACCGCTTTGCTTTTGCTGCCCGTCATGGCCTTCGCCCTGACAGGGT
GCGGCCTGACCCAGAGCGTCGCTGACGGCGCCAAATCGACCGTGAGAGCGGCTTTTTATAAAAAAATAAA
GGTATTGCATCTGGATTTTGTTGCCCGGGAAATGTTGAACACCGATGCGCGCGAGAGCAGTTCCGCATCA
CAGCCGCTGGTGATTCGCATTTATCAGCTACGGGATCGTAAGGCCTTTGACACGCTGGTCTATCAGCAAC
TGCTGAAGGAGGATGAAACGCTGCTGACCGGCGATCTGCTTGCCAGCCGCGATGTGGTGCTCAAGCCGGG
CAATGCCGCCATTCTGGATATGCCGATGGATGCCGAGGCGAAATTTGTGGCCGCCGTCGGGCTGTTTCGC
CAGCCGGAGATGGAGAAAAACAGCTGGCGGCTGGTGGTGGCGCGCGAAGCGTTAAACCCGGATACGGTGC
GCGTTATAGAGGCGGATGGCAACAGCCTGACGCTGTTGCCGGAGCGGGAGTAA