SecReT6
Protein ID: 440230389
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1699
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1794395..1794841 [+]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDL0MFD4
KEGG IDsmaf:D781_1699
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-16, Aligned region: 31..117
Protein Sequence: 148 a.a.     [Download]
>gi|440230389|ref|YP_007344182.1| type VI secretion system lysozyme-related protein [Serratia marcescens FGI94]
MAHLHHAPSLYDMLYGNFSGGLDLPLVSEENQVILSVLDNLQRILNARAGTLAHLPDYGLPDMSKILQGM
PGTAHQLMTTLSEVLLKYEPRLKGISVVMLEQATPGELRYAIDAELKDVGLVRYGTEFMPEGKVLLRHMQ
QQRYLDNQ
 
Nucleotide Sequence: 447 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1794395-1794841 Serratia marcescens FGI94, complete genome
ATGGCGCACCTTCACCACGCCCCCTCGTTATACGACATGCTCTACGGCAACTTTAGCGGCGGCCTCGATC
TGCCCCTGGTCAGCGAAGAAAACCAGGTGATTTTGTCGGTGCTGGATAATCTGCAGCGCATCCTCAACGC
CCGGGCCGGTACGCTGGCCCATCTGCCGGACTACGGCCTGCCGGATATGAGCAAAATTCTGCAGGGCATG
CCCGGCACGGCGCACCAGCTGATGACCACGCTCTCTGAGGTGCTGCTGAAGTATGAGCCGCGCCTGAAAG
GCATCAGCGTGGTGATGCTGGAGCAGGCGACGCCCGGCGAACTGCGCTACGCCATCGACGCCGAGCTGAA
AGACGTCGGGCTGGTGCGCTACGGCACCGAATTTATGCCGGAGGGCAAAGTCCTGCTGCGGCATATGCAG
CAGCAACGCTACCTGGATAATCAATAA