SecReT6
Protein ID: 440230390
SecReT6 ID723
T6SS typei2
Gene symbol-
Locus tagD781_1701
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]1795383..1796753 [+]
Producthypothetical protein
NoteTssA
UniProt IDL0MDQ7
KEGG IDsmaf:D781_1701
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.60E-39, Aligned region: 129..172
DUF3702 [PF12486], Evalue: 3.60E-39, Aligned region: 285..424
ImpA-rel_N [PF06812], Evalue: 1.20E-18, Aligned region: 41..99
DUF1320 [PF07030], Evalue: 0.0068, Aligned region: 137..180
DUF1320 [PF07030], Evalue: 0.0068, Aligned region: 400..418
Protein Sequence: 456 a.a.     [Download]
>gi|440230390|ref|YP_007344183.1| hypothetical protein D781_1701 [Serratia marcescens FGI94]
MGSLSERKLKIGGDPRALPDYAVLRDELLKLSHPARPDVEWRTVETLCLRLFEHNGVDLQTAAWYTLARG
HLAGLTGIQEGLALVNALTAYQWSVMWPASVHTRMEIIIGLNQRLQNVLRTLALDDRDELERLYQLEKSL
KRLAETLARHELQQVSRTEGVQQRIRQAITRLENMPDAEAPPAPVTLPALALAVASAGPPERPPAVASQK
PQAADAPPRATRSILGGFIAGACSALLLGGALLWGWSRMAQPSAAEQRQLQSGERQETQLGVLRPLPPQA
EGASEQLQWLTALPPDWPLQHAWRLIGQARAQRPDDPALAQLQQAWRRQLDMNALSPAALSAWHDGMTKL
QRLTDRLNALDEKRGKYLTVSELKSEVFAIMQTFNRAPPVAELLRRYSADAPEMQRKQAEMALAQLQKRY
FLLRAGEEEARLGTAGADGGQRGAPPSAVVQPSGPP
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|440228796|ref|NC_020064.1|:1795383-1796753 Serratia marcescens FGI94, complete genome
ATGGGATCCCTATCTGAACGTAAATTAAAAATCGGCGGCGACCCGCGCGCGCTGCCGGACTATGCCGTGC
TGCGCGATGAACTGCTGAAATTGTCGCACCCGGCGCGGCCGGACGTTGAGTGGCGCACGGTAGAGACGCT
GTGCCTGCGGCTGTTCGAACATAACGGCGTCGATCTGCAGACGGCGGCCTGGTATACGCTGGCGCGGGGG
CATCTTGCCGGGCTGACGGGCATCCAGGAGGGGCTGGCGCTGGTCAATGCGCTGACGGCCTACCAGTGGT
CGGTGATGTGGCCGGCCAGCGTTCATACGCGGATGGAGATTATTATCGGCCTTAACCAGCGGCTGCAGAA
CGTGTTGCGCACGCTGGCGCTGGACGATCGCGATGAGCTGGAACGGCTGTATCAGCTGGAAAAAAGCCTG
AAGCGGCTGGCGGAGACGCTAGCGCGCCACGAGCTGCAGCAGGTCAGCCGCACGGAAGGCGTACAGCAGC
GGATCCGTCAGGCGATTACCCGGCTGGAAAATATGCCTGATGCTGAAGCACCGCCAGCACCGGTGACGCT
GCCGGCGCTGGCGCTCGCCGTTGCATCAGCCGGGCCGCCGGAGCGTCCGCCGGCCGTCGCCTCGCAGAAG
CCGCAGGCGGCCGATGCGCCGCCGCGCGCTACGCGCTCCATACTGGGCGGGTTTATCGCCGGCGCCTGCA
GCGCGCTGCTGCTCGGCGGCGCCCTGTTGTGGGGCTGGAGCCGCATGGCGCAGCCATCGGCGGCGGAACA
GCGGCAGTTGCAGTCTGGCGAGCGGCAAGAGACGCAGTTGGGCGTGCTGCGACCGTTGCCGCCGCAGGCT
GAAGGCGCCAGTGAGCAGTTGCAATGGCTGACGGCGCTGCCGCCGGATTGGCCGTTGCAGCATGCCTGGC
GTTTGATCGGGCAGGCGCGGGCGCAGCGGCCGGATGATCCCGCGCTGGCGCAGCTGCAGCAAGCGTGGCG
GCGGCAGCTGGATATGAATGCGTTGTCACCGGCGGCGTTAAGCGCCTGGCATGACGGGATGACAAAGCTA
CAACGCTTAACCGACCGGTTAAATGCGCTGGATGAAAAGCGCGGCAAGTACCTGACCGTCAGCGAGTTGA
AGTCGGAAGTGTTTGCCATTATGCAGACGTTTAACCGTGCGCCTCCCGTCGCAGAACTGCTGCGTCGTTA
CTCGGCGGATGCGCCGGAGATGCAGCGGAAACAGGCGGAAATGGCGTTGGCACAGCTACAAAAACGCTAT
TTTTTGTTGAGGGCGGGCGAGGAAGAAGCACGTCTGGGAACGGCGGGAGCTGACGGCGGGCAGCGTGGTG
CACCGCCGTCAGCGGTAGTTCAGCCGAGCGGCCCGCCCTGA