SecReT6
Protein ID: 440231414
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2771
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2918666..2919193 [+]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDL0MI96
KEGG IDsmaf:D781_2771
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-34, Aligned region: 19..149
Protein Sequence: 175 a.a.     [Download]
>gi|440231414|ref|YP_007345207.1| type VI secretion lipoprotein, VC_A0113 family [Serratia marcescens FGI94]
MKSSFAPRQWGLSLLMLGALLLSGCMSSAKSVPSRYGLTFDAAPQVNANAGQSPAPIKVRVLLLRSDAEF
MDADFFSLQNDAKSVLGNSLQDSDQFFLTPGQTGKKLSGQSTLETRYIGVIAEYQNLDGKAWRISLPMPA
PTETNFYKVWQFSPDELQAHVVADVNGLRIVKDED
 
Nucleotide Sequence: 528 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2918666-2919193 Serratia marcescens FGI94, complete genome
ATGAAATCATCATTCGCCCCGCGGCAGTGGGGCCTTAGCCTGTTGATGCTGGGCGCGCTGCTGCTCAGCG
GTTGCATGTCTTCGGCAAAAAGCGTCCCATCGCGCTACGGCCTGACGTTCGACGCTGCCCCGCAGGTCAA
TGCCAACGCCGGCCAGAGCCCCGCCCCGATCAAGGTGCGCGTGCTGCTGTTGCGCTCCGACGCGGAATTT
ATGGATGCCGACTTCTTCAGCCTGCAGAACGACGCCAAAAGCGTACTGGGCAACAGCCTGCAGGACAGCG
ACCAGTTTTTCCTGACGCCCGGCCAGACCGGCAAAAAGCTGAGCGGTCAGAGCACGCTGGAGACGCGCTA
TATCGGGGTGATCGCCGAATACCAGAACCTGGACGGCAAAGCCTGGCGCATTTCACTGCCGATGCCTGCC
CCGACCGAAACCAATTTCTATAAGGTCTGGCAATTCTCGCCGGATGAGCTGCAGGCGCACGTTGTGGCCG
ATGTTAACGGTCTGCGCATCGTCAAGGACGAAGACTGA