SecReT6
Protein ID: 440231415
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2772
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2919236..2920582 [+]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDL0MGL9
KEGG IDsmaf:D781_2772
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-151, Aligned region: 19..443
Protein Sequence: 448 a.a.     [Download]
>gi|440231415|ref|YP_007345208.1| type VI secretion protein, VC_A0114 family [Serratia marcescens FGI94]
MKDAHKVVWSEGMFLRPHHFQQAENYLESYVRNWGQAHNGCFWGFLTLELDQTLLRQGKIALTAASGIMP
DGTPFRFNGAQQAPAPLAIAENKTGENVVLALPTYRAGREDVIFQESPDALARYLAYENEVDDLNAVSVG
SAALQFGNLRLRLMLESDLNAEWTAMTVTRVLEKRGDNSLRLEPDLIPPTLNCQSSPVLKTFINDLQGLL
QQRSQQMSQRLLQPGRGGSSEMVDFMLLQLVNRYLGQVSHAWHLEHLHPERLFAEWLQFATELSSFSPQR
TPEGRLPVYDHDNPALSFGKLMLLLRQGLSVVLEDNAIQLTLVERSHGLNVATVQDTKMMRDFGFVLAVR
ADVAADVLLTHFPAQMKIAPVTRIRDLVQLQLPGIGLRTMPAAPRQIPYHAGYTYFELEKGGDLWKQMEK
SSAFALHLAGEFPGLDMEFWAIRSHTDR
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2919236-2920582 Serratia marcescens FGI94, complete genome
ATGAAAGATGCTCATAAAGTGGTCTGGAGTGAAGGGATGTTTCTGCGTCCCCACCACTTCCAGCAGGCGG
AAAACTACCTCGAGAGTTACGTACGTAACTGGGGACAGGCGCATAACGGGTGTTTCTGGGGCTTTTTGAC
CCTTGAGCTGGATCAGACCCTGCTGCGTCAGGGGAAAATAGCCCTGACCGCCGCCAGCGGCATTATGCCG
GACGGCACGCCATTCCGCTTCAACGGCGCGCAGCAGGCGCCGGCCCCGCTGGCCATCGCCGAAAACAAAA
CCGGCGAAAACGTCGTTCTGGCATTGCCGACCTATCGAGCAGGTCGTGAAGACGTGATCTTCCAGGAGTC
GCCGGACGCGCTAGCGCGCTATCTGGCTTATGAAAACGAAGTGGACGACCTGAACGCGGTCTCCGTCGGC
AGCGCGGCGTTGCAGTTCGGCAACCTGCGCCTACGCCTGATGCTGGAAAGCGATCTGAACGCCGAATGGA
CCGCGATGACCGTCACCCGCGTGCTGGAAAAACGCGGCGACAACAGCCTGCGTCTGGAACCGGACCTGAT
TCCGCCGACGCTCAACTGTCAAAGCAGCCCGGTATTGAAAACCTTTATCAACGATCTGCAGGGCCTGCTG
CAGCAGCGCAGTCAGCAGATGAGCCAGCGCCTGCTGCAGCCGGGCCGCGGCGGCAGTTCCGAAATGGTCG
ATTTTATGCTGCTGCAGTTGGTGAACCGCTATCTCGGTCAGGTCAGCCATGCCTGGCATCTGGAACATCT
GCACCCGGAACGTCTGTTTGCCGAGTGGCTGCAGTTCGCTACCGAGCTGTCCAGCTTCTCACCGCAGCGC
ACGCCGGAAGGCCGCCTGCCGGTGTACGACCACGATAACCCGGCGCTGAGCTTCGGCAAGCTGATGCTGC
TGCTGCGTCAGGGGCTGTCGGTGGTGCTGGAAGACAACGCCATCCAGCTCACCCTGGTCGAACGTTCGCA
CGGGCTGAACGTGGCGACGGTGCAGGACACCAAAATGATGCGCGACTTCGGCTTTGTGCTGGCGGTGCGC
GCCGACGTCGCCGCCGACGTGCTGCTGACCCACTTCCCGGCGCAGATGAAAATCGCCCCGGTCACGCGCA
TCCGCGATCTGGTGCAGCTGCAGCTGCCGGGCATCGGCCTGCGCACCATGCCCGCCGCGCCGCGTCAGAT
CCCCTACCACGCCGGCTATACCTACTTCGAACTGGAGAAAGGCGGCGATCTGTGGAAGCAGATGGAAAAA
TCCAGCGCCTTCGCCCTGCATCTGGCAGGGGAGTTCCCGGGTCTGGACATGGAATTCTGGGCTATTCGCA
GCCATACGGACCGATAA