SecReT6
Protein ID: 440231416
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2773
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2920586..2921809 [+]
Producttype VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDL0MGJ7
KEGG IDsmaf:D781_2773
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-69, Aligned region: 13..218
DUF2077 [PF09850], Evalue: 1.90E-69, Aligned region: 343..378
OmpA [PF00691], Evalue: 6.40E-17, Aligned region: 283..381
Protein Sequence: 407 a.a.     [Download]
>gi|440231416|ref|YP_007345209.1| type VI secretion system OmpA/MotB family protein [Serratia marcescens FGI94]
MTQENIQAAQWDNPLVAAANPLLNAISQIRQSATHANPAQLRQQLIDEVRRFEVRGQRANLPYEVIIGAR
YCLCTALDEAAALTPWGSNSVWSGSGLLVTFHNETWGGEKFFQLLAKLSQSPREHINLLELVNYCLLLGF
EGRYRVMENGRSQLETMKQRLLQLIRSVRGGYAPPLSPNAVDLPVQQKLWRPLVPLWACAALTGFLASLL
FIVLNWRLGDATSPVLASIYQTNLPQVTIGNPAPAAPPVLSLKSFLRKEIAEGLVVVRDEAQQSVVILKG
DGLFNSAATSVRPAYVPVIDRIAKAMNGVSGKILVTGYSDSQPIRSARFASNWELSLARAEAVSERLQKH
LDNPQRVKAEGRGESNPVAPNNSKENRALNRRVEITLLVAPENTQAEINGLQQGNGK
 
Nucleotide Sequence: 1224 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2920586-2921809 Serratia marcescens FGI94, complete genome
ATGACACAGGAAAACATCCAGGCCGCGCAGTGGGATAACCCGTTAGTGGCCGCCGCCAATCCGCTGCTGA
ATGCGATCTCGCAAATCCGGCAGTCGGCGACGCACGCCAATCCGGCGCAGCTGCGTCAGCAATTGATCGA
TGAGGTTCGTCGTTTCGAAGTGCGCGGTCAGCGCGCCAATCTGCCGTATGAAGTGATTATCGGCGCGCGC
TACTGCCTGTGCACCGCGCTGGATGAAGCAGCCGCTCTCACCCCCTGGGGCAGCAACAGCGTCTGGTCAG
GCAGCGGCCTGCTGGTGACCTTCCATAACGAGACCTGGGGCGGTGAAAAGTTCTTCCAACTGCTGGCCAA
ACTGTCGCAAAGTCCGCGCGAGCACATCAACCTGCTGGAGCTGGTCAACTACTGCCTGTTGCTGGGCTTT
GAAGGCCGCTACCGGGTGATGGAGAACGGCCGTTCGCAGCTGGAAACCATGAAACAGCGCCTGCTGCAGC
TGATTCGTTCGGTACGCGGCGGCTATGCGCCGCCGCTGTCGCCCAACGCGGTCGATCTGCCGGTGCAGCA
AAAACTGTGGCGGCCGCTGGTGCCGCTGTGGGCCTGCGCGGCGCTGACCGGTTTTCTCGCCTCGCTGCTG
TTTATCGTCCTCAACTGGCGTCTGGGCGATGCTACCAGCCCGGTGCTGGCTTCAATCTACCAGACCAACC
TGCCGCAGGTGACGATCGGCAACCCGGCGCCGGCCGCGCCGCCGGTGCTGAGCCTGAAGAGCTTCCTGCG
CAAAGAAATCGCCGAAGGTCTGGTGGTGGTGCGCGACGAAGCGCAGCAGAGCGTGGTAATCCTCAAAGGC
GACGGGCTGTTTAACTCCGCCGCCACCAGCGTGCGCCCGGCGTACGTCCCGGTTATCGACCGCATCGCCA
AGGCGATGAACGGCGTCAGCGGCAAGATTCTGGTGACCGGCTACAGCGACAGCCAGCCGATCCGCAGCGC
CCGCTTCGCCTCGAACTGGGAACTGTCGCTGGCGCGCGCCGAAGCGGTTAGCGAACGGCTGCAAAAGCAT
CTTGATAACCCTCAGCGGGTGAAAGCGGAAGGCCGCGGCGAAAGTAATCCGGTCGCGCCGAATAACAGTA
AAGAGAACCGTGCATTGAACCGCCGGGTTGAAATTACGCTGTTGGTTGCGCCAGAAAATACTCAGGCGGA
AATCAACGGACTGCAGCAAGGAAACGGAAAGTAA