SecReT6
Protein ID: 440231419
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2776
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2926225..2927256 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDL0MIA1
KEGG IDsmaf:D781_2776
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.90E-20, Aligned region: 52..111
Protein Sequence: 343 a.a.     [Download]
>gi|440231419|ref|YP_007345212.1| type VI secretion-associated protein, ImpA family [Serratia marcescens FGI94]
MAIETLLTPIDADSPCGDNLEYDADFLAMEQACAGKAEQQFGDTIIPAEAPDWVQVERLATALFERTKDL
RVMLPLTRAWAQLRGLQGYADGLTLIHQALDRYWEPLLPLLEFDGEADPLFRINVLADLGDKSALTSCVR
SAWLLKSAAGEITLRDACSLLDGSKQECASFPGGRARLQDELAQQEQPAVTLVRTILQQLAAIRDIVTRH
LGESALPEMHSLLKMFNVIEQAGATAQPEVAAPEPHDEQQAATPASAGAVPTTAAVFNWRNAQIQSRDDA
QLMLEKVKSYFQLNEPSHPAPLMIDRVQRLITLDFMQIVRDLAPDGLNQLETILGRTDNDDNN
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2926225-2927256 Serratia marcescens FGI94, complete genome
ATGGCTATAGAAACTCTGCTGACCCCGATTGACGCGGATTCTCCCTGCGGCGACAACCTGGAGTATGACG
CTGACTTTTTAGCGATGGAACAGGCCTGCGCCGGCAAGGCTGAACAGCAGTTCGGCGACACCATTATTCC
GGCCGAGGCACCGGACTGGGTGCAGGTGGAACGCCTGGCGACCGCGCTGTTCGAGCGCACCAAGGATCTG
CGCGTCATGCTGCCGCTGACTCGTGCTTGGGCGCAGCTGCGCGGCCTGCAAGGCTATGCGGACGGCCTGA
CGCTGATTCATCAGGCGCTGGACCGCTACTGGGAACCGCTGTTGCCGCTGCTGGAATTCGACGGCGAGGC
GGATCCGCTGTTTCGTATTAACGTCCTGGCCGACCTTGGCGACAAGTCTGCCCTCACCAGTTGCGTACGC
TCCGCCTGGCTGCTGAAAAGCGCTGCCGGCGAGATTACACTGCGCGACGCCTGCTCGCTGCTGGACGGCA
GCAAACAGGAGTGCGCCTCCTTCCCCGGCGGTCGCGCCCGTCTGCAGGATGAGCTGGCCCAGCAGGAGCA
GCCGGCGGTAACGCTGGTGCGCACCATCCTCCAGCAGCTGGCCGCCATTCGCGACATCGTGACCCGCCAT
CTGGGCGAGAGCGCGCTGCCGGAGATGCACAGCCTGCTGAAGATGTTCAACGTCATTGAGCAGGCCGGCG
CTACGGCGCAGCCGGAGGTCGCCGCGCCGGAACCGCATGACGAGCAGCAAGCCGCAACCCCTGCCAGTGC
TGGTGCCGTACCGACCACTGCGGCAGTGTTCAACTGGCGCAACGCGCAGATTCAGTCGCGCGACGATGCC
CAATTGATGCTGGAAAAGGTAAAAAGCTATTTTCAACTGAATGAACCCAGCCATCCGGCGCCGCTGATGA
TTGACCGCGTGCAGCGCCTGATTACCCTGGACTTTATGCAAATTGTCCGCGACCTGGCGCCCGATGGTCT
CAATCAACTGGAAACCATTCTTGGGCGCACTGATAACGACGACAATAACTGA