SecReT6
Protein ID: 440231420
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2777
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2927387..2927926 [+]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDL0MGM1
KEGG IDsmaf:D781_2777
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-59, Aligned region: 13..165
Protein Sequence: 179 a.a.     [Download]
>gi|440231420|ref|YP_007345213.1| type VI secretion protein, VC_A0107 family [Serratia marcescens FGI94]
MANSKSRSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKPVDPQPSVDERKFLDIDID
NFDERMKSLKPRVAYQVDNTLTGEGKLNIDLSFESMDDFSPAAIARKVDSLDGLLEARTQLSNLLSYMDG
KNGAEELISQILQNPELLKSLTNAPKPAEPKDDNNERED
 
Nucleotide Sequence: 540 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2927387-2927926 Serratia marcescens FGI94, complete genome
ATGGCAAACTCGAAATCCCGCAGCGGACAGAAGTTCATCGCCCGCAACCGCGCGCCGCGCGTCCAGATTG
AATATGATGTCGAAATCTACGGTGCAGAACGCAAAATTCAGCTGCCGTTTGTAATGGGTGTGATGGCGGA
TTTGGTCGGTAAACCGGTAGACCCGCAGCCGAGCGTCGACGAGCGCAAGTTCCTCGACATCGACATCGAC
AACTTCGACGAGCGTATGAAGTCGTTGAAGCCGCGCGTGGCCTACCAGGTAGACAATACCCTGACCGGTG
AAGGGAAACTGAATATCGATCTGTCCTTTGAAAGCATGGACGATTTCTCCCCTGCCGCCATCGCCCGCAA
AGTTGACTCACTGGACGGCCTGCTGGAAGCACGCACCCAGCTGTCCAACCTGCTTTCCTATATGGACGGT
AAAAACGGCGCCGAAGAGCTGATCTCCCAGATCCTGCAAAATCCGGAGCTGTTGAAATCTCTGACTAACG
CGCCGAAACCGGCAGAGCCAAAAGACGACAATAACGAGCGTGAGGATTAA