SecReT6
Protein ID: 440231421
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2778
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2927930..2929435 [+]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDL0MGK0
KEGG IDsmaf:D781_2778
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.70E-197, Aligned region: 67..493
Protein Sequence: 501 a.a.     [Download]
>gi|440231421|ref|YP_007345214.1| type VI secretion protein, EvpB/VC_A0108 family [Serratia marcescens FGI94]
MSNSPQQQQALQTSETLSNDEFSALLNKEFRPKTDQAKEAVANAVKTLAQQALENTVTVSSDAYRTIQAL
IAEIDEKLSQQINKIIHHEDFQKLEGAWHGLHYLVNNSETDELLKIRFMSISKKELGRTLKRHKGVGWDQ
SPIFKKIYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLGEMAKISAASHCPFIAGTAPSVMQMESWQEL
SNPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLARLPYGIRTNPVDEFDFEEDTDGATHGNYTWT
NAAYAMATNINRSFKEYGWCTAIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGF
MPLVHRKNSDFAAFIGAQSLQKPAEYYDADASANAQLSARLPYLFACCRFAHYLKCIVRDKIGSFRERDD
MERWLNDWIMNYVDGDPANSSQETKSRKPLAAAEVQVEEIEDNPGYYSAKFFLRPHYQLEGLTVSLRLVS
KLPSLKKNDAS
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2927930-2929435 Serratia marcescens FGI94, complete genome
ATGAGCAACTCGCCTCAGCAACAACAAGCGTTACAAACCAGCGAAACCTTATCCAACGACGAGTTCAGCG
CGCTGTTGAACAAAGAGTTTCGTCCGAAGACCGATCAGGCGAAAGAAGCCGTCGCCAACGCGGTGAAAAC
CCTGGCGCAGCAGGCGCTGGAAAACACCGTGACCGTATCCTCCGACGCTTACCGCACCATTCAGGCGTTG
ATCGCGGAGATTGACGAGAAGCTGTCGCAGCAAATCAACAAAATCATTCACCATGAAGATTTCCAGAAGC
TGGAAGGCGCCTGGCACGGCCTGCACTATCTGGTCAACAACTCGGAAACCGACGAGCTGCTGAAAATCCG
CTTTATGAGCATCTCGAAGAAAGAGCTGGGCCGCACGCTGAAGCGCCACAAGGGCGTGGGCTGGGACCAA
AGCCCGATCTTCAAGAAAATCTATGAAGAAGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCTGCCTGG
TGGGCGACTACTACTTCGACCACAGCCCGCAGGACGTTGAACTGCTGGGCGAAATGGCCAAGATCAGCGC
CGCGTCGCACTGCCCGTTCATCGCCGGCACCGCGCCAAGCGTGATGCAGATGGAATCCTGGCAGGAGCTG
TCCAATCCGCGCGATCTGACCAAGATCTTCCAGAATACCGAATACGCCGCTTGGCGCAGCCTGCGCGAAT
CGGAAGACGCCCGCTACCTGGGCCTGGTGATGCCGCGCTTCCTGGCGCGCCTGCCTTACGGCATCCGCAC
CAACCCGGTTGACGAATTTGACTTCGAAGAAGATACCGACGGCGCGACGCACGGCAACTACACCTGGACC
AACGCCGCCTATGCGATGGCGACCAACATCAACCGCTCCTTCAAAGAGTACGGCTGGTGTACCGCAATCC
GCGGGGTGGAATCCGGCGGCGCCGTAGAGAACCTGCCGTGCCATACCTTCCCGAGCGACGACGGCGGCGT
GGATATGAAGTGCCCGACCGAAATCGCCATCAGCGACCGTCGCGAGGCGGAACTGGCGAAAAACGGCTTT
ATGCCGCTGGTACACCGCAAGAACTCCGACTTTGCCGCCTTTATCGGCGCCCAGTCGCTGCAGAAGCCGG
CGGAATACTACGACGCCGACGCCTCGGCCAACGCCCAGCTGTCCGCACGCCTGCCGTACCTGTTCGCCTG
CTGCCGCTTTGCACATTACCTGAAGTGCATCGTGCGCGACAAAATCGGTTCCTTCCGCGAGCGCGACGAT
ATGGAACGCTGGCTGAACGACTGGATCATGAACTACGTGGACGGCGACCCGGCCAACTCCTCGCAGGAAA
CCAAATCCCGCAAACCGCTGGCCGCGGCGGAAGTTCAGGTGGAAGAGATCGAAGACAACCCGGGCTACTA
CAGCGCCAAGTTCTTCCTGCGTCCGCATTACCAGCTGGAAGGCCTGACCGTTTCCCTGCGTCTGGTGTCG
AAACTGCCTTCGCTGAAGAAAAACGACGCGTCCTGA