SecReT6
Protein ID: 440231432
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2789
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2935395..2937281 [+]
ProductFHA domain protein
NoteFha
UniProt IDL0MJX2
KEGG IDsmaf:D781_2789
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.80E-07, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0095, Aligned region: 33..49
UreE_N [PF02814], Evalue: 0.0095, Aligned region: 78..99
Protein Sequence: 628 a.a.     [Download]
>gi|440231432|ref|YP_007345225.1| FHA domain protein [Serratia marcescens FGI94]
MRFSIVKNKNGQNPPQSSCDFLPPGGTIGRSVDNNLVLPDEERAISRLQAIVHISADGECRITNRGNVTR
VLLNDIPLERGRQVELQDGDILGIDDYQIQVNDLNQQAAPVQQPAAQPVAQAPVADAAPAAKANGAAPIP
NEIWDSLVEEFTPISAAAAVPPKAEPAPQPDHNPLLDRPQRELNPSDPLGQLAGDVDLHQLQQKQTDPAE
LFKTDSTFERDNILTDTTPSALLAENQPKQAKPEASKRPQPAVTESSNNKDEELDPLALFGDSGAPSAPG
ATNSNDPLGLLMGGAVPLTQPEAAPSAVAPQTPAATPEPPKPQAAPQPKIEPKAKPQPQPQPQPQPQPQP
QPQVQPKPTPKPQPQAAAPQEPPRPAPEPLIQPEATPHAEPQPRSRPSNRLGIDPVAYQNARVQSATAAP
NGDALEGPLLAALLQGIGLDDLQPQPHFDEQQVRQVGRLLSLFSQGTVALLSSRSILKRGVKAEMTMILD
EANNPFKLLPSGKTVLMQMFGSQMPGFMPPEQAVRDALIDLQAHQLGMIAGIRAIIAAMLQSFNPDRLEE
EARKEGSAPRLALPSNRKAALWDYFVKNYQQTSGEIEDDFHTLFGEAFLHAYDVEVNQYKDSQTKPDV
 
Nucleotide Sequence: 1887 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2935395-2937281 Serratia marcescens FGI94, complete genome
ATGCGATTTTCTATTGTAAAAAACAAAAATGGCCAAAACCCGCCGCAAAGCAGTTGCGACTTCCTGCCGC
CGGGCGGCACCATCGGCCGCAGCGTAGACAATAACCTGGTTCTGCCGGATGAAGAGCGTGCAATTTCCCG
CCTGCAGGCCATTGTGCATATTTCCGCTGACGGCGAGTGCCGCATCACCAACCGCGGCAACGTCACCCGC
GTCCTGCTTAACGATATTCCGCTGGAGCGCGGCCGTCAGGTGGAGCTGCAGGATGGCGATATCCTCGGTA
TCGATGACTACCAGATCCAGGTCAACGACCTGAATCAACAGGCCGCGCCGGTTCAACAACCGGCAGCGCA
GCCGGTCGCCCAAGCGCCGGTCGCCGATGCCGCGCCGGCCGCCAAGGCAAACGGCGCCGCGCCGATCCCT
AACGAAATCTGGGATAGCCTGGTGGAAGAGTTCACGCCAATTAGCGCCGCCGCGGCCGTACCGCCGAAGG
CGGAGCCTGCGCCGCAGCCCGACCATAATCCGCTGCTCGACCGGCCGCAGCGCGAGCTGAACCCCAGCGA
CCCGCTGGGCCAGTTGGCTGGCGATGTCGATCTGCATCAGCTGCAGCAAAAGCAGACCGACCCGGCCGAA
CTGTTTAAGACCGACAGCACCTTCGAGCGCGACAATATTCTGACCGACACCACCCCGAGCGCACTGCTGG
CGGAAAACCAGCCGAAGCAGGCCAAGCCTGAGGCGTCAAAACGTCCGCAGCCGGCGGTGACGGAGAGCAG
CAATAATAAAGACGAAGAGCTGGATCCGCTGGCGCTGTTCGGCGACTCCGGTGCGCCCAGCGCGCCGGGT
GCCACAAACAGCAACGATCCGCTGGGGCTGCTGATGGGCGGTGCCGTGCCGCTGACGCAGCCGGAAGCTG
CACCGAGCGCAGTCGCGCCGCAAACGCCGGCAGCAACGCCTGAGCCGCCAAAACCGCAGGCTGCGCCACA
GCCAAAGATCGAGCCAAAGGCCAAACCGCAACCGCAACCGCAACCGCAACCGCAACCGCAACCGCAACCG
CAACCGCAGGTTCAGCCAAAACCGACGCCGAAACCACAGCCGCAGGCTGCCGCACCGCAGGAGCCGCCGC
GCCCGGCACCCGAGCCGCTGATACAGCCGGAGGCCACGCCGCATGCCGAACCGCAGCCGCGCTCCCGTCC
GAGCAACCGGCTAGGCATCGACCCTGTCGCCTACCAGAACGCCCGCGTCCAGAGCGCGACGGCCGCGCCT
AACGGCGACGCGCTGGAAGGCCCGCTGCTCGCCGCGCTGCTGCAGGGCATCGGCCTGGACGATCTGCAGC
CGCAGCCGCATTTTGACGAGCAGCAGGTGCGCCAGGTCGGCCGTCTGCTGAGCCTGTTCTCCCAGGGCAC
CGTCGCCCTGCTCTCTTCACGCTCCATTCTCAAACGCGGCGTGAAGGCGGAGATGACCATGATCCTCGAC
GAGGCCAACAACCCGTTCAAACTGCTGCCGTCCGGGAAAACCGTGCTGATGCAGATGTTCGGCAGCCAGA
TGCCGGGCTTTATGCCGCCGGAACAGGCGGTGCGCGATGCGCTTATCGACCTGCAGGCGCACCAGTTGGG
GATGATCGCCGGCATTCGCGCCATTATCGCCGCCATGCTGCAGTCCTTTAACCCGGACCGGCTGGAAGAA
GAAGCGCGTAAAGAGGGCTCCGCCCCGCGTCTGGCGCTGCCTTCCAACCGCAAAGCGGCGCTGTGGGACT
ATTTTGTGAAAAATTACCAGCAGACCTCGGGCGAGATCGAAGACGACTTCCATACGCTGTTTGGCGAAGC
CTTCCTGCATGCCTATGATGTTGAAGTGAATCAGTACAAAGACTCCCAAACCAAACCGGACGTGTAA