SecReT6
Protein ID: 440231435
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2792
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2939092..2939913 [+]
Productprotein of avirulence locus involved in temperature-dependent protein secretion
NoteTagJ
UniProt IDL0MGN1
KEGG IDsmaf:D781_2792
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.90E-43, Aligned region: 43..58
ImpE [PF07024], Evalue: 1.90E-43, Aligned region: 148..269
Protein Sequence: 273 a.a.     [Download]
>gi|440231435|ref|YP_007345228.1| protein of avirulence locus involved in temperature-dependent protein secretion [Serratia marcescens FGI94]
MKSLTDVLQGGSVSAATLAVEADIKARPADADLRAALVQLLCLSGNWQRAKAQLKSWQALKPMAQPTTLL
LLQSVEAELQRQAVFAGQAAPALLKQDQPWLGLMIQALQLDAAGDAAQAQALRDQALEDAPAGSGSLLLA
DGGEEKTVAFDWLTDGDGRLGPVCELALNGTYYWLPFSAIAEIQFQAPQSAIDLVWSHALVRLTDGREQV
CQLPARYPLAADSDDALLLGKRTEWQPLGDSLHYLGYGLKTWLSDSDEFPLHSLRQLSFDQDA
 
Nucleotide Sequence: 822 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2939092-2939913 Serratia marcescens FGI94, complete genome
GTGAAATCATTAACCGACGTATTACAAGGCGGCTCCGTCAGCGCAGCCACCCTGGCGGTGGAAGCCGATA
TCAAAGCGCGCCCGGCCGACGCCGATCTGCGCGCGGCGCTGGTACAGCTATTGTGCCTGAGCGGCAACTG
GCAGCGCGCCAAAGCGCAGCTCAAATCCTGGCAGGCGCTGAAACCAATGGCGCAGCCGACCACCCTGCTG
CTGCTGCAGTCGGTCGAGGCCGAACTGCAGCGTCAGGCGGTGTTTGCCGGCCAGGCCGCGCCGGCGCTGC
TGAAGCAGGATCAGCCCTGGCTCGGGCTGATGATTCAGGCGCTGCAGCTGGACGCGGCCGGCGACGCCGC
ACAGGCGCAGGCGCTGCGTGACCAGGCGCTGGAAGACGCGCCGGCCGGCAGCGGCAGCCTGCTGCTGGCG
GACGGCGGTGAGGAAAAAACCGTCGCCTTCGACTGGCTGACCGACGGCGACGGTCGCCTCGGCCCGGTAT
GCGAGCTGGCGCTCAACGGCACCTATTACTGGCTGCCGTTCTCCGCCATCGCCGAGATCCAGTTCCAGGC
GCCGCAAAGCGCCATCGATCTGGTGTGGAGCCATGCGCTGGTGCGCCTGACCGACGGCCGCGAACAGGTG
TGCCAACTGCCGGCGCGCTATCCATTGGCGGCAGACAGCGACGACGCTCTGCTGCTCGGCAAACGCACCG
AATGGCAGCCGCTTGGCGACAGCCTGCACTACCTCGGCTACGGCCTGAAAACCTGGCTGAGCGACAGCGA
CGAGTTTCCGCTGCACAGCCTGCGTCAGCTGAGCTTCGATCAGGACGCCTGA