SecReT6
Protein ID: 440231436
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2793
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2939915..2940493 [+]
Producthypothetical protein
NoteTssE
UniProt IDL0MGL2
KEGG IDsmaf:D781_2793
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-17, Aligned region: 60..171
DUF2113 [PF09886], Evalue: 0.0059, Aligned region: 93..143
Protein Sequence: 192 a.a.     [Download]
>gi|440231436|ref|YP_007345229.1| hypothetical protein D781_2793 [Serratia marcescens FGI94]
MNDKHLWGNHNGDDLRRQGYRQRQDSERLTSRDKIQPVLLDLLTDDEPHKKQEAQVRNLVSHSELRRRVL
RDLQWLFNCVNSEANLDLGDFPQVRRSTVNYGVASLAGKRMSDIEWQDVQRVLTESILNFEPRILPEGLQ
VRCISDTGSLELHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFDLKDIG
 
Nucleotide Sequence: 579 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2939915-2940493 Serratia marcescens FGI94, complete genome
ATGAACGACAAGCACCTATGGGGCAATCATAACGGCGACGATCTGCGCCGGCAGGGATACCGTCAGCGTC
AGGACAGCGAACGTCTGACCTCACGCGACAAGATACAGCCGGTGCTGCTCGACCTGCTGACCGACGACGA
ACCGCATAAAAAGCAGGAAGCGCAGGTCCGCAATCTGGTCTCGCACAGCGAACTACGGCGGCGCGTGCTG
CGCGATCTGCAGTGGTTGTTTAACTGCGTCAACAGCGAAGCGAATCTCGACCTCGGCGATTTTCCTCAGG
TGCGCCGCTCCACGGTGAATTACGGCGTCGCCTCGCTGGCGGGCAAACGGATGTCGGACATCGAATGGCA
GGATGTTCAGCGCGTGCTGACCGAGTCGATCCTGAATTTTGAGCCGCGCATACTGCCCGAAGGCCTGCAG
GTGCGCTGCATTTCCGACACCGGCTCACTGGAACTGCACAACGTGTTATCGATTGAAATCAAGGGCCGCC
TGTGGTGCGTGCCCTATCCGCTGGAGTTTCTGTTCAGAACCGACGTCGACCTGGAAAACGGCCACTTCGA
TCTGAAAGACATAGGGTAA