SecReT6
Protein ID: 440231437
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2794
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2940498..2942384 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDL0MJX7
KEGG IDsmaf:D781_2794
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.80E-217, Aligned region: 5..628
Protein Sequence: 628 a.a.     [Download]
>gi|440231437|ref|YP_007345230.1| type VI secretion protein, VC_A0110 family [Serratia marcescens FGI94]
MDSKLLEYYNRELAYLREMGAEFAEQYPKVAGRLGMRGIDVADPYIERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEIIYPNYLSPTPSMAIAELQPDSSKGDISNGFTVPRGTMMDSQTLKKNGITCSYTTAHDVTLQP
VRLKSVELGGIPADIPFSSLGLQNRGCVSALRIRLECYDSVTLNSLDLDNLMFYLSGPDMQAQQLLELLM
QHSVGMLCQTVEPQPQRRVLADDALRQEGFAPEQALLPNDLRNFDGYRLLQEYFAFPARFQFFSISGLQP
LLRSVRESKKTLRQFEIVVLLDRHDAALERVIDVSHLALHCTPVINLFPKVAERITLNEKNHEYHLVVDN
IRPLDYEVFSVQRLGGSASEKRYEQEFRPFYSTLSEDDGNYGAYFSLRREQRTLSSHARRYGTRTGYVGS
EVFVSLVDERQSPWHSDLKYLTADVLCTSRDLPLMLMQQDQGNFVMPDSIPIKRVFLRKGPTPPRPALAE
GMITWRLISQLQLNYLSLMDGDPEQGAASLRQLLGLYGNLSEPAIAKQIQGVRSCNLRPVYRRVPEPGPI
VFARGIAIDLTVDDQAFSGNSPYLLGSVLERLFSRLVAMNTFTEMTLSSQQRGEIAHWQARMGKRTLI
 
Nucleotide Sequence: 1887 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2940498-2942384 Serratia marcescens FGI94, complete genome
ATGGACAGTAAACTGTTAGAGTATTACAACCGCGAACTGGCCTATCTGCGCGAGATGGGCGCGGAATTCG
CCGAGCAGTACCCGAAGGTCGCCGGGCGTCTGGGCATGCGCGGCATCGACGTGGCGGATCCCTATATTGA
GCGGCTGATGGAGGGCTTCGCCTTCCTGACCTCGCGCGTACAGCTGAAGATGGACGCGGAATTTCCGCGT
TTCTCCCAGCGGCTGCTGGAAATTATCTATCCGAACTACCTGTCGCCCACGCCGTCGATGGCGATAGCCG
AGCTGCAGCCGGACAGCAGCAAAGGCGACATCAGCAACGGTTTTACCGTTCCGCGCGGCACCATGATGGA
CAGCCAGACGCTGAAGAAGAACGGCATCACCTGCAGCTACACCACCGCCCACGACGTCACGCTGCAGCCG
GTGCGGCTGAAAAGCGTGGAGCTGGGCGGCATTCCGGCCGATATTCCGTTCTCCTCCCTCGGGCTGCAAA
ACCGCGGCTGCGTCAGCGCGCTGCGCATCCGGCTCGAGTGCTACGACAGCGTTACGCTGAACAGTCTGGA
TCTCGACAACCTGATGTTCTACCTCTCCGGGCCGGACATGCAGGCGCAGCAGCTGCTGGAACTGCTGATG
CAGCACAGCGTCGGCATGCTGTGCCAGACGGTGGAGCCGCAGCCGCAGCGGCGCGTGCTGGCGGATGACG
CGCTGCGTCAGGAGGGCTTTGCCCCGGAACAGGCGCTGCTGCCGAACGACCTGCGCAACTTCGACGGCTA
CCGCCTGCTGCAGGAATACTTCGCCTTCCCGGCGCGCTTCCAGTTCTTCAGCATCAGCGGCCTGCAGCCG
CTGCTGCGCAGCGTGCGCGAAAGCAAAAAAACGCTGCGTCAGTTTGAGATCGTGGTGCTGCTGGACCGGC
ACGACGCCGCGCTGGAGCGGGTGATCGACGTCAGCCACCTGGCGCTGCACTGCACGCCGGTGATCAACCT
GTTCCCGAAAGTGGCCGAACGCATCACCCTTAACGAAAAAAATCATGAATACCACCTGGTGGTCGATAAT
ATCCGTCCGTTGGATTATGAGGTGTTCTCGGTGCAACGGCTGGGCGGCAGCGCCAGCGAAAAACGCTACG
AACAGGAGTTCCGGCCGTTTTACAGCACGCTGAGCGAAGATGACGGCAACTACGGCGCCTACTTCTCGCT
GCGGCGCGAACAGCGCACCCTCTCCTCCCACGCCCGGCGCTACGGCACCCGCACCGGCTATGTCGGTTCC
GAAGTGTTCGTCTCGCTGGTGGATGAGCGCCAGTCGCCCTGGCACAGCGATCTGAAATACCTGACGGCCG
ACGTGCTGTGCACCAGCCGCGATCTGCCGCTGATGCTGATGCAGCAGGATCAGGGCAACTTTGTGATGCC
GGACTCCATCCCGATCAAGCGGGTGTTCCTGCGTAAAGGGCCGACGCCGCCGCGCCCGGCGCTGGCGGAA
GGCATGATCACCTGGCGGCTGATCAGCCAGCTGCAGCTTAACTACCTGAGCCTGATGGACGGCGATCCGG
AACAGGGCGCGGCCAGCCTGCGTCAGCTGCTCGGCCTGTACGGCAACCTGAGCGAGCCGGCGATCGCCAA
ACAGATCCAGGGCGTGCGCAGCTGCAACCTGCGGCCGGTGTACCGCCGGGTGCCGGAGCCGGGGCCGATC
GTGTTCGCCCGCGGCATCGCCATCGATCTCACCGTCGACGATCAGGCGTTCTCCGGCAACAGCCCTTATC
TGCTCGGCAGCGTGCTGGAACGGCTGTTCTCACGGCTGGTGGCGATGAATACCTTTACCGAAATGACGCT
GTCCAGCCAGCAGCGCGGTGAAATCGCCCACTGGCAGGCGCGCATGGGCAAAAGGACGCTAATATGA