SecReT6
Protein ID: 440231438
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2795
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2942381..2943451 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDL0MK43
KEGG IDsmaf:D781_2795
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-108, Aligned region: 32..335
Protein Sequence: 356 a.a.     [Download]
>gi|440231438|ref|YP_007345231.1| type VI secretion protein, VC_A0111 family [Serratia marcescens FGI94]
MSESVTELPASDAPQINALHRLPDDFWLRLRAAPYRYDLFQLLRRLDAQGGQAYLLGRAPLPRHEMLRLG
QEPSLSFAPSTLAKVTPRSGSPLHDVSILSFGLFGPNGPLPLHLTEYARERIYHHQDSTLTAFANLFHHR
LTLLFYRAWADAQPTVSLDRPDNGSFNDYLSSLIGNGQPAQRQRDSINAHAKHFMAGHLIRHSRDPEGLS
KILRGYFQVPVRIVENVPHWLRVDPREQARLKGGRGAPRLGESAFLGVAVRDVQHKFRIELGPMSQQEYD
RFLPGAELCEQLRDWVRQYLGIEFVWEVKLILAKEQLIGTQLGGAQRLGLSSWMAAERRQHDAGDLIFSP
EPLEDI
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2942381-2943451 Serratia marcescens FGI94, complete genome
ATGAGTGAAAGCGTAACCGAACTGCCGGCCAGCGATGCGCCGCAGATCAACGCGCTGCACCGCCTGCCGG
ACGACTTCTGGCTGCGGCTGCGCGCCGCGCCTTACCGTTACGATCTGTTCCAGCTGCTGCGGCGGCTGGA
CGCCCAGGGCGGCCAGGCCTATCTGTTGGGACGCGCCCCGCTGCCGCGCCATGAGATGCTGCGCCTGGGG
CAGGAGCCGTCGCTCTCATTCGCGCCGTCGACGCTGGCCAAGGTCACGCCGCGCAGCGGCAGCCCGCTGC
ATGACGTGTCGATTCTGAGCTTCGGCCTGTTCGGCCCCAACGGCCCGCTGCCGCTGCACCTGACCGAGTA
CGCGCGCGAACGGATTTATCACCATCAGGACAGCACCCTGACGGCCTTCGCCAACCTGTTTCATCACCGC
CTGACGCTGCTGTTCTACCGCGCCTGGGCCGATGCGCAGCCGACGGTGTCGCTCGACCGGCCCGACAACG
GCAGCTTTAACGATTATCTGTCGAGCCTGATCGGCAACGGCCAGCCGGCGCAGCGCCAGCGCGACAGCAT
CAACGCGCACGCCAAGCATTTTATGGCCGGTCATCTGATTCGCCACAGCCGCGACCCGGAAGGCCTGAGC
AAGATTTTACGCGGCTATTTCCAGGTGCCGGTGCGCATCGTGGAGAACGTGCCGCACTGGCTGCGGGTTG
ACCCGCGCGAACAGGCGCGGCTGAAAGGCGGACGCGGCGCCCCGCGCCTGGGGGAATCGGCGTTTCTCGG
CGTGGCGGTGCGCGACGTGCAGCACAAGTTCCGCATCGAACTCGGCCCGATGTCGCAGCAGGAGTATGAC
CGTTTCCTGCCCGGCGCCGAGCTGTGCGAGCAGCTGCGCGACTGGGTGCGCCAGTATCTGGGCATTGAAT
TTGTCTGGGAGGTCAAGCTGATTCTGGCGAAGGAACAGCTGATCGGCACCCAGCTTGGCGGCGCACAGCG
GCTGGGACTCAGCAGCTGGATGGCCGCCGAACGGCGTCAGCACGACGCCGGCGATCTGATCTTCAGCCCG
GAACCGCTGGAAGATATTTAA