SecReT6
Protein ID: 440231439
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2796
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2943535..2946252 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDL0MIB9
KEGG IDsmaf:D781_2796
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-39, Aligned region: 226..244
AAA_2 [PF07724], Evalue: 1.90E-39, Aligned region: 636..801
AAA [PF00004], Evalue: 3.90E-21, Aligned region: 226..359
AAA [PF00004], Evalue: 3.90E-21, Aligned region: 642..726
ClpB_D2-small [PF10431], Evalue: 1.00E-15, Aligned region: 207..220
ClpB_D2-small [PF10431], Evalue: 1.00E-15, Aligned region: 809..883
AAA_5 [PF07728], Evalue: 1.50E-12, Aligned region: 226..246
AAA_5 [PF07728], Evalue: 1.50E-12, Aligned region: 352..362
AAA_5 [PF07728], Evalue: 1.50E-12, Aligned region: 641..759
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 34..79
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 126..193
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 203..243
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 271..304
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 494..559
AAA_16 [PF13191], Evalue: 6.10E-09, Aligned region: 637..686
Sigma54_activat [PF00158], Evalue: 3.30E-07, Aligned region: 220..240
Sigma54_activat [PF00158], Evalue: 3.30E-07, Aligned region: 297..306
Sigma54_activat [PF00158], Evalue: 3.30E-07, Aligned region: 641..755
AAA_22 [PF13401], Evalue: 8.80E-07, Aligned region: 52..80
AAA_22 [PF13401], Evalue: 8.80E-07, Aligned region: 226..307
AAA_22 [PF13401], Evalue: 8.80E-07, Aligned region: 374..392
AAA_22 [PF13401], Evalue: 8.80E-07, Aligned region: 640..676
AAA_19 [PF13245], Evalue: 2.20E-06, Aligned region: 225..248
AAA_19 [PF13245], Evalue: 2.20E-06, Aligned region: 639..663
AAA_14 [PF13173], Evalue: 3.10E-06, Aligned region: 59..78
AAA_14 [PF13173], Evalue: 3.10E-06, Aligned region: 226..306
AAA_14 [PF13173], Evalue: 3.10E-06, Aligned region: 333..392
AAA_14 [PF13173], Evalue: 3.10E-06, Aligned region: 640..751
Zeta_toxin [PF06414], Evalue: 3.40E-06, Aligned region: 123..157
Zeta_toxin [PF06414], Evalue: 3.40E-06, Aligned region: 226..242
Zeta_toxin [PF06414], Evalue: 3.40E-06, Aligned region: 635..691
AAA_25 [PF13481], Evalue: 2.10E-05, Aligned region: 208..250
AAA_25 [PF13481], Evalue: 2.10E-05, Aligned region: 280..323
AAA_25 [PF13481], Evalue: 2.10E-05, Aligned region: 352..397
AAA_25 [PF13481], Evalue: 2.10E-05, Aligned region: 477..515
AAA_25 [PF13481], Evalue: 2.10E-05, Aligned region: 631..663
AAA_17 [PF13207], Evalue: 2.60E-05, Aligned region: 226..281
AAA_17 [PF13207], Evalue: 2.60E-05, Aligned region: 453..504
AAA_17 [PF13207], Evalue: 2.60E-05, Aligned region: 641..677
IstB_IS21 [PF01695], Evalue: 3.70E-05, Aligned region: 35..61
IstB_IS21 [PF01695], Evalue: 3.70E-05, Aligned region: 209..247
IstB_IS21 [PF01695], Evalue: 3.70E-05, Aligned region: 641..666
NACHT [PF05729], Evalue: 4.30E-05, Aligned region: 16..84
NACHT [PF05729], Evalue: 4.30E-05, Aligned region: 226..261
NACHT [PF05729], Evalue: 4.30E-05, Aligned region: 641..680
AAA_29 [PF13555], Evalue: 9.80E-05, Aligned region: 218..243
AAA_29 [PF13555], Evalue: 9.80E-05, Aligned region: 639..666
AAA_18 [PF13238], Evalue: 0.00023, Aligned region: 226..249
AAA_18 [PF13238], Evalue: 0.00023, Aligned region: 642..670
Arch_ATPase [PF01637], Evalue: 0.00029, Aligned region: 205..239
Arch_ATPase [PF01637], Evalue: 0.00029, Aligned region: 278..310
Arch_ATPase [PF01637], Evalue: 0.00029, Aligned region: 640..683
Clp_N [PF02861], Evalue: 0.00033, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.00033, Aligned region: 115..143
FtsK_SpoIIIE [PF01580], Evalue: 0.00056, Aligned region: 210..269
FtsK_SpoIIIE [PF01580], Evalue: 0.00056, Aligned region: 455..512
FtsK_SpoIIIE [PF01580], Evalue: 0.00056, Aligned region: 640..660
T2SE [PF00437], Evalue: 0.0041, Aligned region: 208..242
T2SE [PF00437], Evalue: 0.0041, Aligned region: 638..718
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 224..242
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 297..306
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 607..662
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 710..734
TIP49 [PF06068], Evalue: 0.0072, Aligned region: 226..247
TIP49 [PF06068], Evalue: 0.0072, Aligned region: 275..306
TIP49 [PF06068], Evalue: 0.0072, Aligned region: 640..677
Hpr_kinase_C [PF07475], Evalue: 0.0087, Aligned region: 226..238
Hpr_kinase_C [PF07475], Evalue: 0.0087, Aligned region: 638..659
Protein Sequence: 905 a.a.     [Download]
>gi|440231439|ref|YP_007345232.1| type VI secretion ATPase, ClpV1 family [Serratia marcescens FGI94]
MSEISRSVLFGKLDSLLFTSLESATAFCKLRGNPYVELAHWLHQLMQAQDGDLQQIIRHFALDEDQLTRD
IVDALDRLPRGASAISDLSEHIDSAVERAWVYGSLKFGAHAIRGGHLLLGILKTYSLRHLLKAISGQFDR
INADLLMDQFAAIVGSSSENDLAPSAAGEPASAAVPGQSGGSVLAQYAQDMTARARSGEIDPVSGRDEEI
RQIIDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIVAGDVPPQLRDVQLYLLDIGMLQAGAGMKGEFEK
RLQTVIDEVQSSPTPIILFIDEIHTLIGAGGAQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDP
ALTRRFQVVQVHEPDEEKALLMLRSTVSPLEQHHRVLLLDEAVDAAVRLSHRYIPARQLPDKAVALLDTA
CARVAVSQHAEPAQVEDCRHRIDALQIELDIARRETKVGIGDPQRPAAIEAQLSELQQQLTQLSERWQEE
LGLIGQIIDLRAQLHQQDAESADDAAPEDGEQAPEERAESAEPAEAAEPAPSADELRAQLAGLQQQLAAL
QGETPLIFAAVDANIVAAVVADWTGIPLGRMVKNEIEAVLQLSDTLNERVIGQRHALDLIARRVRTSRAR
LDDPNKPVGVFLLAGPSGVGKTETALALAETLYGGEQNVITINMSEFQESHTVSTLKGAPPGYVGYGEGG
VLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVFDKGWMEDGEGRHIDFRNTIIILTSNVGTDLIAGLCS
DPDLMPEPEALSGALRQPLLEVFPAALLGRLLVVPYYPLTDATLGNIVRLQLGRVQRRLTENHDITTTFD
DAVIEQIVSRCTEVESGGRMVDAILTNTLLPQISHTLLSASANDQRYRQLHIALQNNEFICQFQA
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2943535-2946252 Serratia marcescens FGI94, complete genome
ATGTCAGAAATCAGCCGCTCGGTACTCTTTGGCAAACTGGATAGCCTGCTTTTCACCTCCCTGGAAAGCG
CCACGGCTTTTTGTAAGCTGCGTGGCAACCCTTATGTTGAACTGGCGCACTGGCTGCATCAGCTGATGCA
GGCGCAGGATGGCGATCTGCAGCAGATTATCCGCCACTTCGCCCTCGATGAAGACCAGCTGACGCGCGAT
ATCGTCGACGCCCTGGACCGCCTGCCGCGCGGCGCCAGCGCCATCTCCGACCTGTCCGAGCATATCGACA
GCGCGGTAGAGCGCGCCTGGGTCTACGGCTCGCTGAAGTTCGGCGCGCACGCCATCCGCGGCGGCCATTT
ACTGCTGGGGATCCTGAAAACCTACAGCCTGCGCCATCTGCTAAAGGCGATTTCCGGCCAGTTCGATCGC
ATCAACGCCGATCTGCTGATGGATCAGTTTGCCGCCATTGTCGGCAGCTCGTCGGAAAACGACCTGGCGC
CAAGCGCCGCCGGCGAGCCGGCCTCCGCGGCCGTGCCCGGCCAGTCCGGTGGCAGCGTGCTGGCGCAGTA
CGCGCAGGACATGACGGCGCGCGCGCGCAGCGGCGAGATCGACCCGGTCAGCGGCCGTGACGAAGAGATC
CGCCAGATTATCGATATTCTGATGCGCCGCCGGCAGAACAACCCGCTGCTGACCGGCGAGGCCGGCGTGG
GTAAAACCGCCGTGGTGGAAGGCCTGGCGCTGCGCATCGTCGCCGGCGACGTGCCGCCGCAGCTGCGCGA
CGTGCAGCTGTACCTGCTGGATATCGGCATGCTGCAGGCCGGCGCCGGCATGAAGGGCGAGTTTGAAAAA
CGCCTGCAGACGGTGATTGATGAAGTACAGTCCAGCCCGACGCCGATCATTCTGTTTATCGATGAAATTC
ATACGCTGATCGGCGCCGGCGGCGCACAGGGCACCGGCGACGCCGCCAACCTGCTGAAGCCGGCGCTGGC
GCGCGGCCAGTTGCGCACCATCGGCGCCACCACCTGGGCGGAATATAAGAAATATATCGAGAAAGACCCG
GCGCTGACCCGCCGCTTCCAGGTGGTGCAGGTACATGAGCCGGACGAAGAAAAAGCGCTGCTGATGCTGC
GCAGCACCGTCAGCCCGTTGGAACAGCACCACCGCGTGCTGCTGCTCGACGAGGCGGTCGACGCCGCAGT
GCGCCTCTCCCACCGCTATATTCCTGCGCGTCAGCTGCCGGATAAGGCGGTGGCGCTGCTGGACACCGCC
TGCGCCCGCGTTGCGGTCAGCCAGCATGCCGAACCGGCGCAGGTGGAAGACTGCCGCCACCGCATCGACG
CGCTGCAGATTGAGCTGGATATCGCCCGCCGTGAAACCAAGGTCGGCATCGGCGATCCGCAGCGCCCGGC
GGCGATTGAAGCGCAGCTGAGCGAGCTGCAGCAACAGCTGACGCAGCTGAGCGAACGCTGGCAGGAAGAG
CTGGGGCTGATTGGACAGATCATCGACCTGCGCGCCCAGCTGCACCAGCAGGACGCAGAGTCGGCCGACG
ACGCCGCGCCGGAGGACGGGGAACAGGCGCCAGAGGAACGCGCCGAGAGCGCGGAGCCGGCTGAAGCCGC
AGAGCCGGCGCCGTCGGCGGATGAACTGCGCGCTCAGCTGGCCGGACTGCAGCAGCAGCTGGCCGCGCTG
CAGGGCGAAACGCCGCTGATCTTCGCCGCGGTGGACGCCAATATCGTCGCCGCCGTGGTCGCCGACTGGA
CCGGCATCCCGCTGGGCCGCATGGTGAAGAATGAAATCGAGGCGGTGCTGCAGCTGTCCGATACCCTGAA
CGAACGGGTGATCGGCCAGCGTCACGCACTGGACCTGATCGCCCGTCGCGTGCGCACCTCGCGCGCCCGG
CTGGACGACCCGAACAAACCGGTGGGCGTTTTCCTGCTGGCCGGCCCGTCCGGCGTCGGCAAGACCGAAA
CCGCGCTGGCGCTGGCGGAAACGCTGTACGGCGGCGAGCAGAACGTCATCACCATCAACATGAGCGAGTT
CCAGGAATCGCACACCGTATCGACGCTGAAGGGCGCGCCTCCGGGCTATGTCGGCTACGGCGAGGGCGGC
GTGCTGACCGAGGCGGTGCGCCGCCGTCCTTACAGCGTGGTGCTGCTGGACGAAATTGAAAAAGCGCACC
CGGACGTGCACGAAATCTTCTTCCAGGTGTTCGACAAAGGCTGGATGGAGGACGGCGAAGGCCGCCATAT
TGATTTCCGCAACACCATCATTATTCTGACCTCCAACGTCGGCACCGATTTAATCGCCGGCCTGTGCAGC
GACCCGGACCTGATGCCGGAGCCGGAAGCCCTGAGCGGCGCGCTGCGCCAGCCGCTGCTGGAGGTGTTCC
CGGCGGCGCTGCTCGGTCGTCTGCTGGTGGTGCCTTACTACCCGCTGACCGACGCCACGCTGGGCAACAT
CGTGCGTCTGCAGCTGGGCCGCGTCCAGCGCCGACTGACGGAAAACCACGACATTACCACCACCTTCGAC
GACGCGGTGATCGAGCAAATCGTCAGCCGCTGCACCGAGGTGGAATCCGGCGGGCGTATGGTCGACGCCA
TCCTGACCAACACCCTGCTGCCGCAAATCAGCCATACCCTGCTGTCGGCCAGCGCCAACGACCAGCGTTA
CCGCCAGCTGCATATCGCGCTGCAAAACAACGAGTTTATTTGTCAATTTCAGGCTTAA