SecReT6
Protein ID: 440231441
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2798
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2947838..2950423 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDL0MGL5
KEGG IDsmaf:D781_2798
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.70E-79, Aligned region: 24..330
Phage_GPD [PF05954], Evalue: 6.70E-79, Aligned region: 692..740
Phage_base_V [PF04717], Evalue: 8.80E-25, Aligned region: 368..461
Protein Sequence: 861 a.a.     [Download]
>gi|440231441|ref|YP_007345234.1| Rhs element Vgr protein [Serratia marcescens FGI94]
MLDRITAYTPLGPEQLLFRSLEGTEALSAPFDFRIELLSTDARLDRKALLGQPLTLEIPIPGLLRPPRYL
NGKITAIAVSSEEISGTRYSVYTLRVQPDLWPMLKDRNFRIFQEQTVPQIVKALLAEQNIQLEDQLTGAY
RQWGYCVQYGESIFNFISRLMELEGIYYYFKHEQDKHTMVLADNPHHHRPFPGYETIPYHVTPSGGVTNE
EGISQWTLADRVTPGIYSVDDYDFRKPNAWLFQARQNPVSPAPGQIDVYDWPGRYTEHQQGEFYARVRQE
SWQAEHQQFTGTATALGIAPGCTFTLAKAPYMSDNGEYLTLSARYTLRENSYASGDTQGSVHRIEFTVIP
ANVPFRPAQSTSWPKTHGPQTARVVGPQGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQG
FGGVQIPRVNDEVVIDFINGDPDRPIVIGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDNANALRFED
KAGSEQVWIQAERNMDTNVKNDESHTIDNDHAHLVGGNQFKRVVLNQTSGVKGDASALTGKTRSDAVVNA
FTLGSGKSLRLECGESVIELLANGQINITGTSFNLTVKGDGEINTGGQLNLNQSGGAARAVAPGSGHQAE
IQSAVDQLFPNEKKSVAQGKPVNAAPRVTVTAPASITQNTQSITKPGRIDNRVVKSVMASEGSTGEQGGR
HELYGFRKGNGNAYDKILAARNQYGQGSAEEFEEVSKAMSASAKSAGALNFTDPGKQGAITSLAHMRGSS
GAQAILNSMESGRIVKADTLTPEAISKIKSMSSKDFQDNLLKARVAYDRAIYGNTITTQGGKQYNWWARY
GNGLQKRYAREAEEFLKLSNE
 
Nucleotide Sequence: 2586 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2947838-2950423 Serratia marcescens FGI94, complete genome
ATGTTAGACCGCATTACAGCCTATACGCCACTTGGCCCTGAACAACTGCTGTTTCGCTCGCTGGAGGGCA
CCGAAGCCCTGTCTGCGCCGTTTGATTTCCGCATCGAACTGCTCAGCACCGACGCCCGCCTGGACCGCAA
GGCGCTGCTCGGCCAACCGCTGACCCTGGAGATCCCAATCCCGGGCCTGCTGCGCCCGCCCCGCTATCTC
AACGGCAAGATCACCGCCATCGCCGTCAGCAGCGAAGAGATCAGCGGCACCCGCTATTCGGTGTATACCC
TGCGCGTACAGCCCGACCTGTGGCCGATGCTCAAGGATCGCAACTTCCGCATCTTCCAGGAGCAGACCGT
CCCGCAAATCGTCAAGGCCCTGCTGGCCGAACAGAACATTCAGCTGGAAGACCAACTGACCGGCGCCTAT
CGCCAGTGGGGTTACTGCGTGCAGTACGGTGAATCCATCTTTAACTTCATCAGCCGCCTGATGGAGCTGG
AAGGCATTTACTACTACTTCAAGCACGAGCAGGACAAACACACCATGGTGCTGGCGGATAACCCGCACCA
TCATCGGCCGTTCCCCGGCTATGAGACCATCCCGTACCACGTCACGCCGTCCGGCGGCGTCACCAATGAG
GAAGGCATCAGCCAGTGGACGCTGGCCGATCGGGTGACCCCCGGCATCTACAGCGTCGACGACTACGACT
TCCGCAAACCCAACGCCTGGCTGTTCCAGGCGCGGCAGAACCCGGTTTCGCCGGCCCCCGGCCAGATTGA
CGTCTATGACTGGCCCGGCCGCTACACCGAGCATCAGCAGGGCGAGTTCTACGCCCGCGTGCGGCAGGAG
TCCTGGCAGGCCGAACATCAGCAGTTTACCGGTACCGCCACCGCGCTGGGCATCGCGCCCGGCTGCACCT
TTACGCTGGCTAAAGCGCCCTATATGTCCGATAACGGCGAATACCTGACGCTCTCCGCCCGCTATACCCT
GCGCGAAAACAGCTACGCCAGCGGCGATACGCAGGGCAGCGTGCACCGCATCGAGTTCACCGTCATCCCG
GCCAACGTGCCTTTCCGCCCGGCGCAGAGCACCTCCTGGCCGAAAACCCACGGCCCGCAGACCGCCCGCG
TGGTCGGCCCGCAGGGCGAGTCGATCTGGACCGACAAATACGGCCGCATCAAGGTGAAGTTCCACTGGGA
CCGACTGGCCAAGGGCGACGACACCAGCTCCTGCTGGGTGCGCGTCTCCAGCGCCTGGGCCGGCCAGGGC
TTCGGCGGCGTGCAGATCCCGCGCGTCAACGACGAGGTGGTGATCGACTTTATCAACGGCGATCCGGACC
GGCCGATCGTCATCGGCCGCGTGTATAACGAAGCCAGCATGCCGCCATGGGCGCTGCCGGCCGCCGCCAC
CCAGATGGGCTTTATGAGCCGTTCCAAGGACGGCACGCCGGACAACGCCAACGCCCTGCGCTTCGAGGAC
AAGGCCGGCTCCGAGCAGGTGTGGATCCAGGCCGAGCGCAATATGGACACCAACGTCAAGAATGATGAGA
GCCATACCATCGATAACGACCACGCCCATCTGGTGGGCGGCAACCAGTTCAAACGGGTGGTGCTCAATCA
GACCTCCGGCGTCAAAGGTGATGCCTCCGCACTGACCGGCAAAACACGCAGCGACGCCGTGGTTAACGCC
TTTACCCTAGGCTCCGGCAAATCGCTGCGCCTAGAGTGTGGCGAAAGTGTGATCGAGCTGCTGGCGAACG
GCCAAATCAATATCACCGGCACCAGCTTCAACCTCACGGTGAAAGGAGATGGAGAGATCAATACCGGCGG
TCAGCTGAATCTCAACCAGTCCGGAGGTGCCGCGCGCGCCGTAGCACCGGGTAGCGGCCATCAGGCTGAG
ATCCAGAGTGCCGTCGATCAGCTGTTTCCGAACGAGAAGAAGAGTGTTGCGCAGGGAAAGCCGGTTAACG
CCGCCCCTCGGGTGACGGTAACGGCACCGGCATCTATCACGCAAAATACCCAGTCGATAACAAAACCCGG
CAGGATTGATAATCGGGTTGTTAAATCGGTCATGGCCTCTGAAGGGAGCACTGGTGAACAAGGTGGACGG
CATGAGTTATACGGATTCAGAAAAGGAAATGGCAATGCCTATGACAAGATCCTTGCTGCCCGTAACCAAT
ATGGTCAAGGTAGCGCAGAAGAGTTTGAGGAAGTATCCAAAGCAATGAGCGCATCGGCAAAATCTGCGGG
GGCATTGAACTTTACCGATCCTGGAAAACAAGGGGCAATAACCTCATTGGCACATATGCGTGGCTCATCT
GGCGCACAAGCGATCCTGAACTCCATGGAATCCGGACGAATAGTTAAGGCTGATACCTTAACACCAGAGG
CAATATCCAAAATTAAAAGCATGTCGTCGAAAGACTTTCAGGATAATTTACTTAAAGCTAGGGTAGCATA
CGATAGAGCAATATATGGGAATACCATCACGACACAGGGTGGTAAACAGTACAACTGGTGGGCTCGTTAT
GGGAATGGCCTTCAAAAACGGTATGCCCGGGAAGCAGAAGAATTTTTAAAATTATCAAACGAGTGA