SecReT6
Protein ID: 440231446
SecReT6 ID724
T6SS typei3
Gene symbol-
Locus tagD781_2803
StrainSerratia marcescens FGI94
Repliconchromosome [GenBank: NC_020064] [Browse all T6SS(s) in this replicon]
Location [Strand]2952893..2954830 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDL0MGL8
KEGG IDsmaf:D781_2803
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-78, Aligned region: 24..330
Phage_base_V [PF04717], Evalue: 7.50E-25, Aligned region: 368..461
Protein Sequence: 645 a.a.     [Download]
>gi|440231446|ref|YP_007345239.1| Rhs element Vgr protein [Serratia marcescens FGI94]
MLDRITAYTPLGPEQLLFRSLEGTEALSTPFDFRIELLSTDARLDRKALLGQPLTLEIPIPGLLRPPRYL
NGKITAIAVSSEEISGTRYSVYTLRVQPDLWPMLKDRNFRIFQEQTVPQIVKALLAEQNIQLEDQLTGDY
RQWGYCVQYGESTFNFISRLMELEGIYYYFKHEQDKHTMVLADNPHHHRPFPGYEIIPYHVTPSGGTTSE
EGISQWTLADRVTPGIYSVDDYDFRKPNAWLFQARQNPVSPAPGQIDVYDWPGRYTEHQQGEFYARVRQE
SWQAEHQQFTGTATALGIAPGCTFTLAKAPYMSDNGEYLTLSARYTLRENSYASGDTQGSVHRIEFTVIP
ANVPFRPAQSTSWPKTHGPQTARVVGPQGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQG
FGGVQIPRVNDEVVIDFINGDPDRPIVIGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDNANALRFED
KAGSEQVWIQAERNMDTNVKNDESHSVGGHHNFIVTKNHESQVNGEYRQSTQYNRSELVGGDYAMKTQQQ
IMLSSGEGITLVSGDSKLTLNPNGTVSIQCTQFEINASAQGEINTGGTLDLNVKKPAKGATPKPTPAEIT
QEVAKVFKGSSEGNA
 
Nucleotide Sequence: 1938 bp     [Download]
>gi|440228796|ref|NC_020064.1|:2952893-2954830 Serratia marcescens FGI94, complete genome
ATGTTAGACCGCATCACAGCTTATACGCCGCTTGGCCCTGAACAACTGCTGTTTCGCTCGCTGGAGGGCA
CCGAAGCCCTGTCCACGCCGTTTGATTTCCGCATCGAACTGCTCAGCACCGACGCCCGCCTGGACCGCAA
GGCGCTGCTCGGCCAGCCGCTGACCCTGGAGATCCCCATCCCGGGACTGCTGCGCCCGCCCCGCTATCTC
AACGGCAAAATCACCGCCATCGCCGTCAGCAGCGAAGAGATCAGCGGCACCCGTTATTCGGTGTATACCC
TGCGCGTACAGCCCGACCTGTGGCCGATGCTCAAGGATCGCAACTTCCGCATCTTCCAGGAGCAGACCGT
CCCGCAAATCGTCAAGGCCCTGCTGGCCGAACAGAACATTCAGCTGGAAGACCAGCTGACCGGCGACTAT
CGCCAGTGGGGCTACTGCGTACAGTACGGTGAATCCACCTTTAACTTCATCAGCCGCCTGATGGAGCTGG
AAGGCATTTACTACTACTTCAAGCACGAGCAGGACAAACACACCATGGTGCTGGCGGATAACCCGCACCA
TCACCGGCCGTTCCCCGGTTATGAGATCATTCCCTACCACGTCACGCCGTCCGGCGGCACTACCAGTGAA
GAAGGCATCAGCCAGTGGACACTGGCCGATCGGGTGACCCCCGGCATCTACAGCGTCGACGATTACGACT
TCCGCAAACCCAACGCCTGGCTGTTCCAGGCGCGGCAGAACCCGGTTTCGCCGGCCCCCGGCCAGATTGA
CGTCTATGACTGGCCCGGCCGCTACACCGAGCATCAGCAGGGCGAGTTCTACGCCCGCGTGCGGCAGGAG
TCCTGGCAGGCCGAACATCAGCAGTTTACCGGTACCGCCACCGCGCTGGGCATCGCGCCCGGCTGCACCT
TTACGCTGGCTAAAGCGCCCTATATGTCCGATAACGGCGAATACCTGACGCTCTCCGCCCGCTATACCCT
GCGCGAAAACAGCTACGCCAGCGGCGATACGCAGGGCAGCGTGCACCGCATCGAGTTCACCGTCATCCCG
GCCAACGTGCCTTTCCGCCCGGCGCAGAGCACCTCCTGGCCGAAAACCCACGGCCCGCAGACCGCCCGCG
TGGTCGGCCCGCAGGGCGAGTCGATCTGGACCGACAAATACGGCCGCATCAAGGTGAAGTTCCACTGGGA
CCGGCTGGCCAAGGGCGACGACACCAGCTCCTGCTGGGTGCGCGTCTCCAGCGCCTGGGCCGGCCAGGGC
TTCGGCGGCGTGCAGATCCCGCGCGTCAACGACGAGGTGGTGATCGACTTTATCAACGGCGATCCGGACC
GGCCGATCGTCATCGGCCGCGTGTATAACGAAGCCAGCATGCCGCCATGGGCGCTGCCGGCCGCCGCCAC
CCAGATGGGCTTTATGAGCCGTTCCAAGGACGGCACGCCGGACAACGCCAACGCCCTGCGCTTCGAGGAC
AAGGCCGGCTCCGAGCAGGTGTGGATCCAGGCCGAGCGCAATATGGACACCAACGTCAAAAATGATGAGA
GCCACTCCGTTGGCGGCCATCACAACTTTATCGTCACCAAAAACCACGAAAGCCAGGTTAACGGCGAATA
CCGCCAGTCAACCCAGTACAACCGCAGCGAGCTGGTGGGCGGCGACTATGCGATGAAGACGCAGCAGCAA
ATCATGCTCAGCTCCGGCGAGGGCATCACGCTGGTGAGCGGCGACAGCAAGCTGACGCTCAACCCGAACG
GCACCGTCTCGATTCAGTGCACCCAGTTTGAAATCAACGCCAGCGCGCAGGGCGAAATCAACACCGGCGG
CACGCTGGATCTCAACGTCAAGAAACCGGCCAAAGGCGCAACGCCGAAGCCGACCCCGGCGGAGATCACG
CAGGAAGTCGCTAAAGTGTTCAAAGGCTCCTCGGAGGGCAACGCATGA