SecReT6
Protein ID: 440288971
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3632
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3769960..3772194 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDL0MA38
KEGG IDebf:D782_3632
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-62, Aligned region: 30..330
Phage_base_V [PF04717], Evalue: 2.30E-26, Aligned region: 368..460
Gp5_C [PF06715], Evalue: 3.70E-05, Aligned region: 9..14
Gp5_C [PF06715], Evalue: 3.70E-05, Aligned region: 502..524
Gp5_C [PF06715], Evalue: 3.70E-05, Aligned region: 517..540
Gp5_C [PF06715], Evalue: 3.70E-05, Aligned region: 547..566
Gp5_C [PF06715], Evalue: 3.70E-05, Aligned region: 564..579
Gp5_C [PF06715], Evalue: 3.70E-05, Aligned region: 579..595
Gp5_C [PF06715], Evalue: 3.70E-05, Aligned region: 612..626
Protein Sequence: 744 a.a.     [Download]
>gi|440288971|ref|YP_007341736.1| Rhs element Vgr protein [Enterobacteriaceae bacterium strain FGI 57]
MSLKGLRFTLTVDGLVPETFAVVDFRLTQAYSSPFVLDVDVASDSFRQTAEKLLEKGAVLTIWQGSTALR
YVSGVVSGFGMKEHNGWQMQYHLQIRPPLWRSGLRQNYRIFQQQDIKAISATLLNEDGVTQWTPRFYESH
PAREFCVQYGESDLAFLTRLWAEEGIFFYDRYADDSPEQTLTLCDDVAGLPVYGEIPFNPNTREVTTACI
SLFRYQAQVRPSQVRSKDHTFKVPDWPGIYIEDAENLNGQLTQYKILDWPGRYKDEQHGQDFTRYRLEGL
RNSAETATGISNSPALWPGRRFTLTGHPVQGANPNREWQVVSSTLTGSQPQALHGSRGRGTTLSNHITVI
PADRTWRSQPLPKPKVDGPQSAVVTGPEGEEIFCDEHGRVRVKFHWDRYHGETEESSCWIRVSQAWAGAG
FGNLAIPRVGQEVIVDFLNGDPDQPIVTGRTYHEDNRSPGDLPGTKTQMTIRSKTYKGSGFNELRFEDAT
SNEQVYIHAQKNMDTEVLNDRTTDVKHDHTETIGNNQKITVGLGQTVKVGKENAGGHDQTITVAHDRIIT
VRNDQTLKVMNDRRVNVSHDDGLYVANDRKVTVEGKQEHKTTGNHISLVEGKHSLEVKGDLARKITGALG
MKVRDEIVLESGGKITLKVGGSFVVIHSGGVDIVGPKINLNGGGSPGTPVPTLQPAVLKALADDKSLAAE
QNDSNASSDQNDNNDEGEEAPEKSVCKECLKRAQEAAAAFAPRG
 
Nucleotide Sequence: 2235 bp     [Download]
>gi|440285501|ref|NC_020063.1|:c3772194-3769960 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGTCATTAAAAGGGCTGCGTTTTACGCTGACGGTGGACGGACTGGTGCCGGAGACGTTTGCGGTGGTGG
ATTTCCGCCTCACCCAGGCATACTCATCGCCGTTCGTCCTGGATGTGGATGTCGCCAGCGACTCGTTCCG
CCAGACGGCGGAGAAGCTGCTGGAGAAAGGGGCCGTGCTGACCATCTGGCAGGGCAGCACGGCGCTGCGT
TATGTCAGCGGTGTGGTGTCGGGGTTCGGGATGAAGGAGCACAACGGCTGGCAGATGCAGTACCACCTTC
AGATACGCCCGCCCCTGTGGCGCAGCGGACTGCGGCAGAACTACCGAATCTTCCAGCAGCAGGACATTAA
AGCCATCTCCGCCACGCTGTTAAACGAGGACGGAGTGACGCAGTGGACGCCGCGCTTTTATGAGAGCCAC
CCGGCCCGGGAGTTCTGCGTCCAGTACGGTGAAAGCGACCTGGCGTTTCTGACCCGGCTGTGGGCGGAGG
AAGGTATCTTCTTTTATGACAGATACGCTGACGACAGCCCGGAGCAGACGCTCACGCTCTGCGATGATGT
GGCGGGTCTGCCGGTGTACGGGGAGATACCGTTTAACCCGAACACCCGCGAGGTGACGACGGCGTGTATC
AGCCTGTTCCGCTACCAGGCGCAGGTGCGCCCCTCGCAGGTGCGTTCAAAAGACCACACGTTTAAGGTGC
CGGACTGGCCGGGTATTTACATTGAGGATGCTGAAAACCTCAACGGGCAGTTAACGCAGTACAAAATTCT
GGACTGGCCGGGGCGCTACAAGGACGAGCAGCACGGTCAGGACTTTACCCGCTACCGGCTGGAAGGGCTG
CGTAACAGTGCTGAAACCGCCACAGGCATCAGTAACTCCCCGGCGCTGTGGCCGGGACGGCGGTTCACCC
TGACGGGGCATCCGGTACAGGGCGCGAACCCGAACCGTGAGTGGCAGGTGGTGAGCAGCACGCTGACGGG
GAGCCAGCCGCAGGCGCTGCACGGGAGCCGGGGGCGGGGAACGACGCTGAGTAACCATATCACGGTCATC
CCGGCAGACCGGACCTGGCGCTCACAGCCCCTGCCGAAGCCGAAGGTGGACGGTCCGCAGAGTGCTGTTG
TCACCGGGCCGGAGGGGGAGGAGATATTCTGCGACGAACACGGGCGGGTGCGGGTGAAGTTTCACTGGGA
CCGTTATCACGGGGAGACGGAGGAGAGTTCGTGCTGGATACGGGTGTCGCAGGCGTGGGCGGGAGCGGGG
TTCGGTAATCTGGCGATACCGCGCGTGGGTCAGGAAGTGATAGTGGACTTTCTGAACGGCGACCCGGACC
AGCCCATTGTGACGGGACGTACCTACCATGAGGACAACCGTTCACCGGGCGACCTGCCGGGAACGAAGAC
GCAGATGACCATTCGCTCAAAAACGTACAAGGGCAGCGGCTTTAATGAACTGCGGTTCGAGGACGCCACC
AGTAATGAGCAGGTGTATATCCACGCGCAGAAGAACATGGATACGGAGGTGCTTAACGACCGGACGACGG
ACGTGAAGCATGACCACACGGAGACCATCGGGAACAACCAGAAAATCACGGTGGGGCTGGGCCAGACGGT
CAAAGTCGGGAAAGAGAATGCCGGGGGACATGACCAGACCATCACGGTGGCCCATGACCGCATCATCACG
GTGCGTAATGACCAGACGCTGAAGGTGATGAACGACCGGCGGGTGAACGTCAGTCACGATGACGGTCTGT
ACGTGGCGAATGACCGAAAGGTGACGGTGGAAGGCAAACAGGAGCACAAAACGACGGGGAACCACATCAG
CCTGGTGGAGGGGAAGCACAGCCTGGAGGTGAAGGGCGACCTGGCGAGGAAAATTACCGGTGCGCTGGGA
ATGAAGGTCCGGGATGAAATCGTGCTGGAGAGTGGCGGGAAAATCACTCTGAAGGTGGGCGGTTCGTTTG
TGGTCATCCATTCTGGTGGCGTGGATATTGTGGGGCCGAAGATTAATCTGAATGGCGGGGGAAGTCCGGG
GACGCCAGTACCGACGCTACAACCGGCGGTTCTGAAAGCGCTGGCAGATGATAAAAGTTTAGCGGCTGAG
CAAAATGATAGTAATGCATCGTCCGATCAGAATGATAACAACGATGAGGGTGAGGAAGCGCCAGAAAAAT
CGGTGTGTAAGGAGTGCCTGAAAAGGGCGCAAGAAGCCGCCGCCGCTTTTGCGCCTCGTGGATAA