SecReT6
Protein ID: 440288972
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3633
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3772410..3772928 [-]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDL0M8D0
KEGG IDebf:D782_3633
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.40E-35, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.004, Aligned region: 93..136
Protein Sequence: 172 a.a.     [Download]
>gi|440288972|ref|YP_007341737.1| type VI secretion system effector, Hcp1 family [Enterobacteriaceae bacterium strain FGI 57]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRAHKPFIF
TVALNKAVPLLYNALASGEMLPKTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|440285501|ref|NC_020063.1|:c3772928-3772410 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGCCAACACCATGTTACATTTCAATTACAGGTCAAACTCAGGGGAACATCACCGCAGGTGCCTTCACAG
CGGATTCTGTTGGTAACATCTACGTGCAGGGCCATGAAGATGAAATGCTGGTTCAGGAGTTCCTGCATAA
CGTCACGGTCCCTACCGATCCTCAATCCGGTCAGCCTTCCGGCCAGCGCGCCCACAAACCGTTCATCTTT
ACGGTGGCGCTGAATAAAGCCGTCCCGCTGCTGTACAACGCGCTGGCTTCCGGTGAAATGCTGCCGAAAA
CCGAACTGCACTGGTGGCGTACTTCTGTTGAAGGCAAACAGGAGCATTATTTCACCACCCGTCTGACCGA
CTCGACAATTGTGGATATGAAACTTCATATGCCGCACTGCCAGGACCCGGCGAAACGCGAGTTTACCCAG
TTGCTCGAAGTTTCTCTGGCCTACCGCAAAATCGAGTGGGAACACGTGAAGTCAGGTACCTCTGGTGCTG
ATGACTGGCGTGCGCCGCTGGAAGCCTAA