SecReT6
Protein ID: 440288973
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3634
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3773631..3774131 [+]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDL0M6R1
KEGG IDebf:D782_3634
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-49, Aligned region: 9..161
Protein Sequence: 166 a.a.     [Download]
>gi|440288973|ref|YP_007341738.1| type VI secretion protein, VC_A0107 family [Enterobacteriaceae bacterium strain FGI 57]
MSSQKNGGSVAPKERINIRYDSKVNNQNAEVELPLNLLVTGNLKGTTDDTPLDERQPIAVNRYNFNAVLE
QAQIEREFTVPSALSEHPDAQLNINLKVKSLNDLSPDAIAARVPETKKLLELREALVALRGPMGNMPAFR
ARLKALLDNEESREKLIAELGLAGRK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3773631-3774131 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGAGCAGCCAAAAAAATGGCGGCAGCGTTGCCCCAAAAGAGCGAATTAATATCAGGTATGATTCGAAGG
TAAATAACCAAAATGCGGAAGTGGAATTGCCCCTTAATTTGCTGGTTACCGGCAATCTGAAGGGAACCAC
AGATGATACACCACTGGATGAGCGCCAGCCAATAGCCGTCAACCGGTACAATTTTAACGCCGTGCTGGAA
CAGGCGCAGATTGAACGGGAGTTTACCGTGCCGTCAGCACTCAGTGAACACCCTGATGCACAACTGAATA
TCAATCTGAAAGTGAAATCGCTGAATGATCTGTCACCGGACGCTATCGCCGCCCGTGTACCAGAAACGAA
GAAACTTCTGGAACTGCGCGAAGCCCTGGTCGCCCTGCGTGGCCCGATGGGAAACATGCCCGCTTTCCGC
GCACGGCTTAAGGCGTTGCTGGATAACGAAGAAAGCCGTGAAAAACTTATTGCTGAGCTGGGCCTTGCAG
GCCGGAAATAA