SecReT6
Protein ID: 440288974
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3635
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3774152..3775633 [+]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDL0M6K7
KEGG IDebf:D782_3635
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.50E-181, Aligned region: 66..490
Protein Sequence: 493 a.a.     [Download]
>gi|440288974|ref|YP_007341739.1| type VI secretion protein, EvpB/VC_A0108 family [Enterobacteriaceae bacterium strain FGI 57]
MSDTLTEASVSTPSVAGPSLLDEIMAQTRFKPESESYGIARQGVTAFITALLQNDDEAESVDILAVNAMI
ADIDTRVGHQMDLILHAPEFQELESFLRSLKLLVDRADPRENIKIHLMHATKEELLDDFEFSPEITQSGL
YRHVYSSGFGQFGGEPFAAVIGNYAFDNSAADMKLLKYISAVSAMAHSPFLSSVSPEFFGLESFTELPAI
KDLAAIFEGPGYTKWRSLRESDDSRNLGLTAPRFLLRHPYAPYENPVKSFNYHEDVSQSHENYLWGNTAF
LLAANMVESFISTRWCPNIIGPQSGGAVKDLPVHMYEAMGQLQSKIPTEILITDRREYELAEQGFITLTM
RKNSDNAAFFSANSIQKPKVFPNSPEGKSAETNYKLGTQLPYLFIISRIAHYLKVLQREQIGSWKERSDV
ERGLNTWIHQLVADQENPPSEVRSRKPLRQAKVEVTDVEGEPGWYRIKLAARPHFKYMGSDFDLTLVGRL
DKD
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3774152-3775633 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGTCAGATACCTTAACGGAAGCATCAGTTTCCACTCCTTCAGTCGCCGGGCCGTCCCTGCTTGATGAAA
TCATGGCACAGACACGTTTTAAGCCAGAATCAGAAAGCTACGGTATTGCCCGTCAGGGTGTGACGGCGTT
TATTACCGCGTTGTTGCAGAATGACGATGAGGCAGAATCTGTCGATATTCTGGCAGTGAATGCGATGATT
GCTGATATTGATACCCGCGTGGGACATCAGATGGATCTGATCCTTCATGCACCGGAATTTCAGGAACTGG
AGTCGTTCCTGCGTTCTTTAAAGCTGTTGGTAGATCGTGCAGATCCCCGCGAAAACATCAAAATCCATTT
GATGCACGCCACTAAAGAAGAATTGCTGGATGATTTTGAATTTTCTCCGGAAATTACCCAGTCAGGACTC
TACCGCCACGTATATTCGAGCGGATTCGGTCAGTTTGGCGGGGAGCCGTTTGCCGCCGTCATCGGTAACT
ACGCCTTCGATAACAGCGCCGCGGATATGAAACTGCTGAAGTATATCAGCGCGGTCAGCGCCATGGCTCA
CAGTCCGTTCCTGTCCTCTGTTTCTCCGGAGTTTTTCGGACTGGAATCATTCACGGAACTGCCTGCCATT
AAAGATCTTGCCGCTATTTTTGAAGGTCCTGGCTATACCAAATGGCGTTCACTGCGCGAATCGGATGACT
CCCGCAACCTTGGCCTGACGGCACCGCGCTTTCTGCTGCGTCACCCCTACGCACCGTATGAAAACCCGGT
AAAAAGTTTCAACTACCATGAAGATGTCAGCCAGAGCCACGAAAACTATTTGTGGGGTAACACAGCGTTT
TTGCTGGCGGCGAATATGGTTGAAAGTTTTATTTCAACCCGCTGGTGTCCGAATATTATCGGTCCGCAGA
GCGGCGGTGCAGTAAAAGACCTGCCTGTGCATATGTATGAGGCTATGGGGCAACTTCAGTCCAAAATTCC
GACTGAGATCCTCATCACGGATCGTCGTGAATATGAGCTTGCAGAACAGGGATTTATTACGCTGACCATG
CGCAAAAACAGCGATAACGCCGCGTTTTTCTCTGCAAACTCGATTCAAAAACCTAAAGTGTTTCCTAACT
CACCGGAAGGTAAGAGCGCCGAAACCAACTACAAACTCGGCACTCAGCTCCCTTATCTGTTCATTATCAG
CCGGATAGCGCATTACCTTAAGGTGCTGCAACGCGAACAGATTGGTTCATGGAAAGAACGCTCAGACGTG
GAAAGAGGACTCAACACCTGGATACACCAGCTTGTGGCCGATCAGGAGAACCCGCCTTCAGAAGTGCGTA
GCCGGAAACCACTGCGTCAGGCGAAGGTTGAGGTGACGGATGTGGAAGGCGAACCGGGCTGGTACCGGAT
AAAACTCGCCGCGCGTCCTCATTTCAAATATATGGGGTCTGATTTTGATCTGACGTTGGTGGGTCGCCTG
GACAAGGATTAA