SecReT6
Protein ID: 440288975
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3636
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3775636..3776064 [+]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDL0M9X6
KEGG IDebf:D782_3636
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-20, Aligned region: 30..121
Protein Sequence: 142 a.a.     [Download]
>gi|440288975|ref|YP_007341740.1| type VI secretion system lysozyme-related protein [Enterobacteriaceae bacterium strain FGI 57]
MSVEREYPLRGSLFERIREAADPSLRRRSKETLLRSVRRNLHNVLNTRSGSCHGSPELGITDLNDDSLAS
SDFRNEVQNAISACILRYEPRISEVKVMAAAEDSYAPLELRFHILAYLNFSNSQDVLEFDILLDTHQHWL
VE
 
Nucleotide Sequence: 429 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3775636-3776064 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGTCAGTGGAACGGGAATATCCCCTCAGAGGAAGTCTGTTTGAGCGCATACGGGAAGCCGCAGATCCGT
CATTGCGTCGGCGTTCAAAGGAGACATTACTGCGCTCTGTACGCCGTAACCTGCACAATGTGCTCAATAC
CCGTTCCGGGAGTTGCCACGGTTCACCGGAGCTGGGGATCACCGATTTAAACGATGACTCCCTGGCATCC
AGTGATTTCAGAAACGAAGTCCAGAACGCAATTAGCGCCTGCATCCTGCGCTACGAACCCCGAATTTCCG
AGGTGAAGGTCATGGCCGCTGCTGAAGACAGCTATGCCCCGCTGGAACTGCGCTTTCATATTCTGGCGTA
TCTGAATTTTAGCAACAGCCAGGATGTGCTGGAGTTTGACATTCTGCTGGACACGCATCAGCACTGGTTA
GTGGAGTAA