SecReT6
Protein ID: 440288976
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3637
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3776072..3777892 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDL0MA42
KEGG IDebf:D782_3637
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-182, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|440288976|ref|YP_007341741.1| type VI secretion protein, VC_A0110 family [Enterobacteriaceae bacterium strain FGI 57]
MAFEERYYREELDYLRRLGKLLAREKPHLAHFLAEKESDPDVGRLLEAFAFLSGNLRQKLEDEFPEFTHG
LINMLWPNYLRPVPAMTIIEYRPKNELKTPVQVNRNELIRTRTSHDVSSLVQDVLSDDDAIPLPACHFTL
TRDIWLQPLSVRDVRNTSTLKEGIIEIDFIAEGKVSPAELDLNKLTFWLGNEDDYTRHQLYLWFSERLMD
AELVAGEYRLPLPALWLDAAGFEREDAQLPWPKNVHNGYRVLQEYFCYPESFFFFHLRDAASLPKDFPVQ
AFTLRLHFNQPLPVDIKLRKDSLRPYCTPAVNLFAHYAEPVRPDGSAPQYPLRASQRHPDSYDIFRVKSV
SSKVAESSDGQQFRLWPEFEGFQHQIEYSHQREVVYWHHRTKSSLFHRGLDHSVSFVHADGSLPDRSLMD
GEVFTASLVCTNRMQPASLHTGDICVAVNKNPAVASFSNVTRPTRPLYPVTDGDMHWSLISCMNLNYLSL
LDRESLIQVLRTFDLPGIHHPQQARLSTQKLDAIERMESRPVDRLFKGVPVRGLSTTLWINPDPFVCDGE
IYLLGSVLSNFFALYASINSFHCLKIINTESQEYWEWQHTGQHALM
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3776072-3777892 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGGCCTTCGAAGAACGTTATTACCGCGAAGAGCTGGATTACCTGCGTCGGCTGGGTAAATTGCTGGCAA
GGGAAAAACCGCATCTGGCCCATTTTCTGGCCGAGAAAGAGAGCGATCCCGATGTCGGACGCCTGCTTGA
GGCATTTGCCTTCCTTTCCGGAAATCTGCGACAAAAACTGGAAGATGAGTTTCCGGAATTTACACACGGG
CTAATCAATATGCTGTGGCCCAATTACCTGCGCCCGGTTCCGGCGATGACGATAATTGAGTATCGCCCTA
AAAATGAGCTAAAAACGCCTGTGCAGGTAAACCGTAATGAACTGATCAGAACACGTACCAGCCATGATGT
TTCGTCTCTTGTTCAGGATGTGCTGTCTGATGATGATGCCATACCGCTTCCTGCCTGCCACTTTACCCTG
ACGCGGGATATCTGGCTGCAACCCCTTTCTGTCCGGGATGTACGTAACACCAGCACCCTCAAGGAAGGCA
TTATTGAGATAGATTTTATTGCCGAGGGTAAGGTTTCTCCTGCCGAACTGGATCTCAATAAACTCACGTT
CTGGCTGGGTAATGAAGATGATTACACCCGCCACCAGCTTTACCTGTGGTTCAGCGAGCGTCTGATGGAT
GCTGAACTGGTGGCCGGTGAATACCGTCTGCCATTACCGGCGCTGTGGCTGGACGCGGCGGGGTTTGAGC
GGGAAGATGCACAGTTACCGTGGCCGAAAAATGTTCACAACGGTTATCGTGTGCTCCAGGAGTATTTTTG
CTATCCGGAAAGTTTTTTCTTCTTCCATCTGCGGGATGCTGCATCGCTGCCGAAAGATTTTCCGGTTCAG
GCCTTTACGCTGCGCCTGCACTTTAACCAGCCGCTTCCGGTCGATATCAAGTTACGTAAAGATTCCCTGC
GTCCCTACTGTACGCCTGCGGTGAATTTGTTCGCGCATTATGCCGAGCCAGTCAGGCCGGATGGCAGCGC
GCCACAGTACCCGCTTCGGGCCAGTCAGCGGCACCCTGATTCCTACGATATCTTCCGGGTAAAATCGGTT
TCCAGCAAGGTCGCCGAATCCTCTGATGGTCAGCAGTTCCGGCTCTGGCCCGAATTTGAAGGTTTCCAGC
ACCAGATTGAATACAGCCACCAGCGTGAAGTAGTGTACTGGCATCACCGGACTAAATCGTCCCTGTTTCA
CCGTGGTCTGGATCATTCTGTTTCTTTTGTTCATGCCGATGGTAGCCTGCCGGATCGTTCCCTGATGGAC
GGTGAAGTATTTACGGCCTCGCTGGTCTGCACTAACCGGATGCAGCCTGCTTCACTGCACACGGGTGATA
TCTGTGTGGCTGTTAACAAAAACCCGGCCGTCGCTTCGTTCAGTAATGTTACGCGCCCGACCCGCCCGCT
CTATCCGGTGACGGATGGCGATATGCACTGGTCGCTGATTTCCTGCATGAACCTGAACTATCTCTCGCTG
CTGGACAGAGAGTCGCTGATTCAGGTGCTTCGCACATTTGACTTACCCGGTATTCATCATCCACAGCAGG
CCCGACTCTCCACGCAGAAACTGGACGCTATTGAGAGAATGGAATCCCGCCCGGTTGATCGCCTGTTCAA
AGGCGTGCCGGTTCGCGGTCTTTCCACCACCTTGTGGATCAATCCCGATCCTTTCGTCTGTGACGGGGAA
ATCTATTTACTGGGGTCAGTGCTGTCGAACTTCTTCGCCCTGTACGCCAGTATCAACTCATTTCACTGTC
TCAAAATCATTAACACGGAAAGTCAGGAGTACTGGGAATGGCAACACACAGGTCAGCACGCCCTGATGTA
G