SecReT6
Protein ID: 440288977
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3638
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3777859..3778902 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDL0M8D6
KEGG IDebf:D782_3638
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.00E-86, Aligned region: 19..334
Protein Sequence: 347 a.a.     [Download]
>gi|440288977|ref|YP_007341742.1| type VI secretion protein, VC_A0111 family [Enterobacteriaceae bacterium strain FGI 57]
MATHRSARPDVGETAFPPDVRGMNFYMLMESLYRRYGAPNQEPSLRTEPEQEVALFKSDASIAFPCSDLS
TLERSDSGQFTLTTKFLGFSGSQSPLPGYYLDRMAQESAQNEEGLKAFLDLFSHRWTQFAYHAWRKYRYY
ICFRNGGTDAFSQRMYSLVGLGNQSVRDRLAINHSKMLAYAGILATPGRSPDVVCNLVSHCFDLPDVSIE
SWQLRKVPVDPTQQNRLGVRNPKKKTAGYVPGRSVIGVNFTLGSRVPDRSGKFLLRISKLSMPRYLSFLP
DGENHKALTLFISFLLRDQLAWDLRLDLAPEQAKGMRLGDRSRSCIGRTAFIGQPKVPPSVTLHIRD
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3777859-3778902 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGGCAACACACAGGTCAGCACGCCCTGATGTAGGGGAAACAGCTTTCCCTCCCGATGTGCGCGGGATGA
ATTTTTATATGCTGATGGAGTCGCTGTACCGCAGGTATGGCGCGCCGAATCAGGAGCCGTCCCTGCGCAC
TGAGCCAGAGCAGGAAGTGGCGCTGTTCAAATCGGATGCCAGTATTGCTTTTCCTTGCAGTGATTTGAGC
ACACTTGAGCGCAGCGATTCCGGGCAGTTTACCCTGACCACAAAATTCCTTGGCTTCTCCGGCAGCCAGT
CACCGTTACCGGGCTACTACCTGGATCGGATGGCGCAGGAGTCTGCGCAGAATGAGGAGGGGCTTAAGGC
GTTTCTCGATCTGTTCAGCCACCGCTGGACGCAGTTTGCCTATCATGCCTGGCGCAAGTACCGCTATTAC
ATCTGCTTTCGTAACGGTGGAACCGATGCATTTTCACAGAGAATGTATTCGCTGGTCGGGCTGGGCAACC
AGAGCGTGCGCGACAGGCTCGCTATCAACCACAGCAAGATGCTGGCCTATGCCGGAATACTGGCGACGCC
GGGGCGCTCGCCGGATGTGGTATGCAACCTGGTCAGCCATTGTTTTGATCTTCCGGACGTCAGTATAGAA
AGCTGGCAGTTACGCAAAGTACCTGTTGATCCCACCCAGCAGAACCGCCTGGGCGTGCGTAATCCTAAAA
AGAAAACTGCCGGTTATGTACCAGGACGTTCAGTGATTGGCGTGAATTTTACTCTCGGTTCGAGGGTGCC
TGATCGTAGCGGAAAATTCCTTTTGCGGATCAGTAAATTGTCAATGCCGCGTTATCTCTCTTTTTTACCC
GACGGTGAAAATCACAAAGCGCTGACCCTGTTTATTTCCTTTCTGTTGCGGGATCAGCTTGCCTGGGATC
TCCGGCTGGATCTGGCTCCTGAGCAGGCAAAAGGAATGCGGCTGGGTGATCGCTCCCGCTCCTGTATCGG
GCGCACAGCGTTTATTGGTCAGCCGAAAGTGCCGCCGTCCGTCACCCTCCACATCAGGGATTAA