SecReT6
Protein ID: 440288978
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3639
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3778907..3780205 [+]
Producttype VI secretion system FHA domain protein
NoteFha
UniProt IDL0M6R6
KEGG IDebf:D782_3639
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 432 a.a.     [Download]
>gi|440288978|ref|YP_007341743.1| type VI secretion system FHA domain protein [Enterobacteriaceae bacterium strain FGI 57]
MELHMAEEKTPSSVLSLTLQVMNGNELESGRAAKCLFTADGGDIGNLPEGHWPVQDRAGSVAGRACRVIL
HDGAFCLKSLMPGLMINQAPVAPDAGLVRLRQGDEITLGSLAVKVFIHEGKLVSYSEHMAAPETIVSNRD
RLEDALLTTEGQPAYPGMPLRHQLADTVVNNFSADPLQAIQAESLTMAGGPLSGIVPERSSTPVRDGVID
VPFMDLPPVYPDPQERHDEMAPTADIAQLHLAVTPLLRGLGSSLAVRNSQDADHFLEEAGRTLQAAIKGL
LDLQQRRNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAI
VESLRVLLDAFSPQSLMRRFVQYRRSHELRQPLDAAGAWKMYSDYYDELASSRQQGFEMLFNEVYAQAYD
RVLREKQREPEA
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3778907-3780205 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGGAATTGCATATGGCTGAGGAAAAAACTCCCTCTTCCGTTCTCTCACTGACATTGCAGGTGATGAACG
GCAACGAACTGGAAAGTGGGCGCGCTGCAAAATGCCTCTTCACTGCTGATGGCGGAGATATCGGCAATCT
GCCTGAAGGCCACTGGCCAGTACAGGACAGGGCTGGCTCTGTTGCCGGTCGCGCCTGCCGGGTGATTTTA
CATGATGGTGCATTTTGTCTGAAGAGTCTGATGCCGGGACTGATGATTAACCAGGCTCCGGTTGCCCCGG
ATGCCGGGCTGGTGCGGCTGCGCCAGGGTGATGAAATCACGCTCGGCTCACTGGCGGTAAAAGTATTTAT
CCATGAAGGCAAGCTGGTGAGCTATAGCGAACACATGGCCGCACCGGAAACCATTGTCAGTAACCGTGAC
CGTCTGGAAGATGCGCTGCTGACAACGGAAGGCCAGCCTGCCTATCCGGGAATGCCCCTGCGTCACCAGC
TTGCGGATACCGTGGTTAACAATTTTTCAGCCGATCCCTTGCAGGCTATCCAGGCTGAAAGCCTGACCAT
GGCGGGCGGTCCACTTTCGGGGATTGTTCCTGAACGGTCATCCACTCCCGTCAGGGATGGTGTGATCGAT
GTACCGTTTATGGACCTGCCTCCCGTATATCCCGACCCACAGGAGCGCCATGATGAAATGGCTCCCACAG
CAGATATCGCGCAGCTTCATCTTGCCGTGACGCCATTGTTGCGCGGTCTTGGCAGTTCGCTTGCTGTACG
TAACTCACAGGATGCGGATCATTTTCTTGAAGAAGCCGGACGAACCCTACAGGCAGCAATAAAAGGCCTG
CTCGATTTACAACAGCGCCGTAACAGCCTGTCGGATAAACATTTGCGCCCGCTGGAAGATAATCCGCTGC
GGCTGAACATGGATTACGCCACCGCGCTTGATGTGATGTTTGCAGAGGGCAAAAGTCCGGTACATCTGGC
GGCCCCCGCCGCCGTCAGTGAAAGTCTGCGTAATGTCCGCCACCACGAAGAGGCTAACCGGGCGGCGATT
GTGGAGTCGCTCCGTGTGCTGCTGGATGCGTTTTCGCCACAAAGTCTGATGCGCCGTTTTGTGCAGTATC
GCCGTAGCCATGAACTGCGCCAGCCTCTGGACGCAGCCGGAGCATGGAAAATGTACAGCGATTATTACGA
TGAACTGGCCTCCAGCCGACAGCAGGGTTTTGAGATGCTGTTTAATGAAGTCTATGCCCAGGCCTATGAC
CGGGTACTTCGTGAGAAACAGCGGGAGCCGGAAGCATGA