SecReT6
Protein ID: 440288979
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3640
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3780202..3780735 [+]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDL0M6L1
KEGG IDebf:D782_3640
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.50E-32, Aligned region: 17..170
Protein Sequence: 177 a.a.     [Download]
>gi|440288979|ref|YP_007341744.1| type VI secretion lipoprotein, VC_A0113 family [Enterobacteriaceae bacterium strain FGI 57]
MTRRYLRACVMVMFFSLTLTGCETVKKLSQVIKNPDIQVGKLADQSSEVTVTLLTEPDTNTNADGEASAV
DIQLVYMSDDSKLQAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPVKLDEKTQFIGIVAYFSD
DQATEWKQIEAVEGSGHNYRLLVHVRQNSIEMKKEEN
 
Nucleotide Sequence: 534 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3780202-3780735 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGACCAGGCGTTATTTACGCGCCTGCGTGATGGTGATGTTTTTCAGTCTCACCCTGACAGGCTGCGAAA
CAGTGAAAAAACTCAGCCAGGTCATAAAGAACCCGGATATTCAGGTCGGGAAGCTGGCGGATCAGTCGTC
AGAGGTGACGGTCACGTTGCTGACCGAGCCGGATACCAATACCAATGCAGACGGCGAAGCAAGTGCCGTG
GACATACAACTGGTGTACATGAGCGACGACTCGAAATTGCAGGCTGCTGACTATGACCAGATCGCCAGTA
CGCCGCTGCCGGATGTGCTGGGTAAAAACTATATCGACCACCAGGACTTTAACCTGCTGCCGGACACTAT
CAAAACCCTGCCGCCAGTGAAGCTGGATGAAAAAACACAGTTTATCGGAATTGTGGCCTATTTCTCTGAT
GACCAGGCCACCGAGTGGAAACAAATCGAAGCGGTGGAAGGTTCAGGCCATAACTACCGTTTGCTGGTGC
ATGTACGGCAGAACAGCATCGAAATGAAAAAAGAGGAAAACTGA