SecReT6
Protein ID: 440288980
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3641
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3780738..3782081 [+]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDL0M9Y0
KEGG IDebf:D782_3641
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-140, Aligned region: 20..446
Protein Sequence: 447 a.a.     [Download]
>gi|440288980|ref|YP_007341745.1| type VI secretion protein, VC_A0114 family [Enterobacteriaceae bacterium strain FGI 57]
MATMKNRVIWYEGLFALPQHFQQQQRNQEYLLNQRLNAQDDFAWGFTSLSINTELLAQGKLMLDGAAGCM
PDGTVFNIPEQDQLPVPYQPVDLSRPGSQDIYLALPVISDITCEIEGRQSAGQGTERYRLARADVRDLHS
DGGDVQQIELGQLAPKIVCGADDLSAMVTLPLCRIRSQQPNGALVLDDSFIPTCQAIRVSPILNGFAGDV
QGLISNRASELAKRIGSPDQSGIADVAEFMMLQMLNRTQMHFTHRTHLHTLHPEAFYLDLVRLLGELMTF
TEDSRLPCAVDVYNHRDLTKSFRTVIPELRRALNTVLMPRAQNLPLVFSDGFYVATVNDPTLLKSGTFIL
AVRARMQHSQLIHQFTQQSKIAATNKIRDMVSVQVPGVPLTPRTAAPRQLPYHDGYVYFELDKGAAAWQD
VIKAGALALHISGSFPELSVQLWAIRG
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3780738-3782081 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGGCGACCATGAAAAACAGGGTGATCTGGTACGAGGGATTGTTTGCCCTGCCACAGCACTTTCAGCAAC
AGCAGCGTAATCAGGAGTATCTGCTGAACCAGCGGCTGAACGCACAGGATGATTTTGCCTGGGGATTTAC
ATCGTTGTCGATCAATACCGAGCTGCTTGCCCAGGGAAAACTCATGCTTGACGGCGCGGCTGGCTGTATG
CCGGATGGCACCGTGTTCAATATCCCGGAGCAGGATCAACTCCCTGTCCCGTATCAGCCCGTTGACCTTT
CCAGGCCCGGAAGCCAGGACATCTATCTGGCTTTGCCGGTCATCAGCGATATTACCTGCGAAATAGAGGG
ACGGCAGAGCGCCGGTCAGGGAACGGAACGTTACCGGCTGGCCCGTGCTGATGTTCGCGATTTGCACTCC
GATGGCGGTGACGTGCAGCAAATCGAACTGGGGCAACTGGCCCCCAAAATCGTCTGCGGCGCGGACGACC
TGAGTGCAATGGTGACATTACCGTTATGCCGTATCCGCAGCCAGCAGCCCAATGGCGCCCTGGTGCTGGA
TGACAGTTTTATTCCCACCTGCCAGGCCATCCGGGTAAGCCCGATACTGAACGGGTTTGCCGGTGATGTG
CAGGGGCTTATCAGCAACCGCGCCAGCGAACTGGCAAAACGCATAGGCTCCCCGGATCAGAGCGGGATTG
CTGATGTGGCCGAATTTATGATGCTACAGATGCTTAACCGGACGCAGATGCACTTCACGCATCGCACCCA
TCTGCATACCCTGCATCCGGAAGCCTTTTATCTGGATCTGGTTCGCCTGCTGGGCGAGCTGATGACGTTT
ACGGAAGACAGCCGTCTGCCCTGTGCGGTTGATGTATACAATCACCGGGATCTCACAAAGTCATTCAGGA
CGGTGATCCCGGAGCTACGCCGGGCGCTCAATACCGTACTGATGCCACGTGCGCAGAACCTGCCGCTGGT
CTTCTCAGACGGGTTTTATGTCGCCACGGTTAACGATCCCACACTGTTGAAGTCCGGCACCTTTATTCTG
GCAGTGCGTGCGCGGATGCAGCACAGCCAGCTTATCCACCAGTTTACCCAGCAGTCAAAAATTGCCGCCA
CCAACAAAATCCGCGATATGGTCAGCGTGCAGGTACCCGGTGTTCCGCTGACGCCACGGACCGCCGCACC
ACGCCAGTTACCTTATCACGATGGCTATGTTTACTTCGAACTGGACAAAGGCGCAGCCGCCTGGCAGGAC
GTGATAAAAGCCGGGGCGCTGGCGCTGCACATTTCCGGCTCGTTCCCTGAACTGAGCGTCCAGTTGTGGG
CGATAAGAGGTTAA