SecReT6
Protein ID: 440288981
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3642
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3782086..3782904 [+]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDL0MA47
KEGG IDebf:D782_3642
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-60, Aligned region: 50..255
Protein Sequence: 272 a.a.     [Download]
>gi|440288981|ref|YP_007341746.1| type IV / VI secretion system protein, DotU family [Enterobacteriaceae bacterium strain FGI 57]
MSEHSVLLPDGDDSQDTVAPPEWENAASHDSGERHSSRQYRLSLRGNSINAMIDAATPLLGMVMRLSTMN
SLMMPEHLFSQVVTDVQAVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNRNEWIKQSLLVHFHN
ETWGGEKVFILLERLIREPKRYQDLLEFLYLCFSLGFRGRYKVAVHNLDEFERIYRRLHHVLHTLRGDAP
FPLLHQDKKTQGGRYQLIKRLTIKHVLLGGIVVLALFYLFYMLRLDSQTQDILHQLNRLLAR
 
Nucleotide Sequence: 819 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3782086-3782904 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGAGCGAGCACTCTGTTTTGCTCCCCGATGGGGATGACAGCCAAGATACCGTCGCCCCACCGGAGTGGG
AAAATGCAGCTTCGCATGATTCGGGTGAACGACACTCCAGCCGCCAGTACCGTCTGTCTCTGCGTGGCAA
CAGCATTAATGCGATGATTGATGCAGCCACGCCGCTACTCGGCATGGTAATGCGCCTTTCAACCATGAAC
AGCCTGATGATGCCGGAGCACCTGTTCAGCCAGGTCGTCACGGATGTTCAGGCGGTGGAGCAGTTGCTTC
AGGAGCAGGGCTATGAACCGGGTGTTATCGTATCGTTTCGCTACATCCTCTGCACTTTTATTGATGAAGC
GGCGCTCGGCAACGGCTGGTCAAACCGAAACGAGTGGATCAAGCAGTCGCTGCTGGTCCATTTCCACAAT
GAAACCTGGGGCGGCGAGAAAGTTTTCATTCTGCTTGAACGCCTGATCCGCGAACCAAAGCGTTATCAGG
ATTTGCTCGAATTTCTGTACCTGTGCTTTTCCCTGGGATTTCGCGGGCGATATAAAGTCGCGGTACACAA
TCTGGACGAATTTGAACGGATATACCGCCGCCTGCACCACGTCCTGCACACACTACGCGGCGATGCGCCT
TTTCCCTTATTACACCAGGACAAAAAAACCCAGGGCGGGCGTTATCAGCTCATAAAACGCCTGACCATAA
AACACGTCCTGCTGGGAGGCATCGTGGTGCTGGCGCTGTTTTATCTGTTCTACATGCTGCGTCTGGACAG
CCAGACACAGGATATTCTGCATCAACTGAACCGGCTACTCGCCAGGTAA