SecReT6
Protein ID: 440288982
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3643
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3782917..3785592 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDL0M8D8
KEGG IDebf:D782_3643
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.70E-38, Aligned region: 611..772
AAA [PF00004], Evalue: 1.40E-16, Aligned region: 32..57
AAA [PF00004], Evalue: 1.40E-16, Aligned region: 223..334
AAA [PF00004], Evalue: 1.40E-16, Aligned region: 473..507
AAA [PF00004], Evalue: 1.40E-16, Aligned region: 617..734
AAA [PF00004], Evalue: 1.40E-16, Aligned region: 746..804
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 446..503
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 616..735
ClpB_D2-small [PF10431], Evalue: 6.70E-12, Aligned region: 778..854
AAA_16 [PF13191], Evalue: 2.00E-09, Aligned region: 21..71
AAA_16 [PF13191], Evalue: 2.00E-09, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 2.00E-09, Aligned region: 263..300
AAA_16 [PF13191], Evalue: 2.00E-09, Aligned region: 430..503
AAA_16 [PF13191], Evalue: 2.00E-09, Aligned region: 587..655
AAA_16 [PF13191], Evalue: 2.00E-09, Aligned region: 682..710
AAA_22 [PF13401], Evalue: 2.30E-06, Aligned region: 33..66
AAA_22 [PF13401], Evalue: 2.30E-06, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 2.30E-06, Aligned region: 447..483
AAA_22 [PF13401], Evalue: 2.30E-06, Aligned region: 615..648
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 447..512
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 611..645
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 739..808
AAA_29 [PF13555], Evalue: 8.40E-05, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 8.40E-05, Aligned region: 614..641
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 222..322
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 616..706
AAA_19 [PF13245], Evalue: 0.0003, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.0003, Aligned region: 610..638
DUF258 [PF03193], Evalue: 0.00052, Aligned region: 199..239
DUF258 [PF03193], Evalue: 0.00052, Aligned region: 617..631
NACHT [PF05729], Evalue: 0.00084, Aligned region: 222..249
NACHT [PF05729], Evalue: 0.00084, Aligned region: 283..345
NACHT [PF05729], Evalue: 0.00084, Aligned region: 477..486
NACHT [PF05729], Evalue: 0.00084, Aligned region: 617..645
Zeta_toxin [PF06414], Evalue: 0.0089, Aligned region: 222..241
Zeta_toxin [PF06414], Evalue: 0.0089, Aligned region: 615..656
IstB_IS21 [PF01695], Evalue: 0.009, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.009, Aligned region: 616..627
Protein Sequence: 891 a.a.     [Download]
>gi|440288982|ref|YP_007341747.1| type VI secretion ATPase, ClpV1 family [Enterobacteriaceae bacterium strain FGI 57]
MIQINLASLVKHLNPFSRQALEAAAAECMSHQASEITVAHVLLQMLASVRSDLRVIAERADIDLNELRRA
LTVENYATPRTTDSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYVPGVAARLLTGI
NRDRLQQDFAQWTRESAETAIQNADGQPVSVATDSGDGLLARYTKNMTADARNGRLDPVLCRDHEIDLMI
DILCRRRKNNPVVVGDAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWQQQQTL
VQEIIALRQALLDQAENTDAAVEEITEPVSPAQRLAQLTTELDTLHNDQLLVSPHVDKKQIAAVIAEWTG
VPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETV
LQMAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPD
VLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVAHADDPETMQEALYPVLADFFKPALLARM
EVVPYLPLSKETLATIIAGKLARLDNVLRSRFGADVIIEPEVTEEIMSRVTRAENGARMLESVIDGDMLP
PLSLLLLQKMAANTAIARIRLSAADGAFTADVEDALPDDAVTPQTEDETVL
 
Nucleotide Sequence: 2676 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3782917-3785592 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGATTCAAATTAATCTGGCCTCGCTGGTTAAACATCTCAATCCGTTTTCCCGTCAGGCGCTGGAAGCGG
CGGCAGCAGAGTGCATGAGCCATCAGGCATCGGAAATTACAGTGGCGCATGTTCTGTTGCAGATGCTGGC
ATCGGTGCGCAGCGACTTAAGGGTGATTGCTGAGCGGGCCGACATCGACCTGAATGAGCTTCGCCGGGCG
CTGACGGTGGAGAACTACGCCACGCCGCGTACAACAGACAGCTACCCGGCATTTTCCCCGATGCTGGTCG
AGTGGCTGAAAGAGGGCTGGCTGCTGGCCTCCGCAGAGATGCAGCACAGCGAACTGCGCGGTGGTGTACT
GCTGCTGGCCCTGCTGCATTCGCCACTGCGTTATGTCCCCGGTGTGGCCGCACGGTTGCTGACCGGCATT
AACCGCGACCGCCTGCAACAGGACTTTGCGCAGTGGACGCGCGAGTCAGCAGAAACCGCGATACAGAATG
CTGACGGTCAGCCAGTGAGCGTTGCGACAGATTCAGGAGATGGTCTTCTGGCCCGCTATACCAAAAACAT
GACCGCAGACGCCCGTAACGGCAGGCTCGACCCGGTGCTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGTCGCCGCCGTAAAAACAACCCGGTGGTGGTGGGCGACGCGGGCGTGGGTAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATTGTGGCAGGCCAGGTGCCGGATAAGCTGAAAAACACCGATATCAT
GACCCTTGACCTGGGCGCATTGCAGGCCGGGGCGTCGGTGAAGGGCGAATTCGAAAAACGTTTCAAAGGG
CTGATGGCAGAGGTCATTTCCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCGCATACCCTTATTG
GCGCGGGCAACCAGCAGGGCGGGCTAGATATCTCCAACCTGCTCAAACCGGCGCTGGCGCGTGGCGAACT
AAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAAAAAGATGCCGCCCTGTCGCGC
CGCTTCCAGTTGGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACTATAATTCTGCGTGGCCTGTCGG
CGGTCTATGAACAGTCTCACGGCGTGCTGATTGATGATGACGCCTTACAGGCCGCCGCGACACTGAGCGA
GCGTTATCTCTCCGGACGTCAGTTGCCGGACAAAGCCATTGATGTGCTGGATACAGCCTGCGCCCGTGTG
GCTATCAACCTTTCATCGCCACCAAAGCAAATCTCGGCGCTGACCACCCTGAGCCACCAGCAGGAGGCGG
AAATTCGTCAGCTTGAGCGTGAGCTTCGCATCGGGCTGCGTACCGATACCTCACGGATGACGGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCCTGGCAGCAGCAGCAGACTCTG
GTACAGGAGATTATCGCGCTGCGCCAGGCATTGCTGGATCAAGCAGAAAACACTGATGCTGCGGTGGAAG
AAATTACTGAACCCGTTTCCCCGGCACAGCGGCTCGCACAGCTCACCACCGAACTGGACACCCTGCATAA
CGACCAGCTACTGGTCTCCCCGCACGTCGATAAAAAACAGATTGCGGCGGTGATTGCCGAATGGACAGGC
GTGCCGCTTAACCGCCTGTCGCAGAATGAAATGTCGGTCATCACAGACCTGCCAAAATGGCTGGGCGACA
CCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTGCATAAACACCTGCTGACTGCACGCGCCGACCTGCG
TCGTCCGGGACGCCCGCTCGGCGCGTTCCTGCTGGCTGGCCCCAGCGGCGTGGGTAAAACCGAAACCGTC
CTGCAAATGGCGGAGCTGCTCTACGGCGGTCGCCAGTACCTGACCACCATCAATATGTCCGAGTTTCAGG
AGAAGCACACCGTCTCGCGGCTGATTGGCTCCCCTCCGGGCTATGTCGGCTATGGCGAAGGCGGCGTACT
GACCGAAGCGATTCGCCAGAAACCCTACTCGGTGGTGCTTTTAGATGAAGTGGAAAAAGCGCACCCGGAT
GTGCTCAACCTGTTCTACCAGGCGTTCGACAAGGGCGAGATGGCAGACGGCGAAGGCCGCCTGATTGACT
GTAAAAACATCGTCTTCTTCCTCACCTCCAACCTCGGATACCAGGTGATTGTCGCACACGCCGATGACCC
GGAGACCATGCAGGAAGCCCTCTATCCGGTGCTGGCGGACTTCTTTAAACCTGCCCTGCTGGCGCGTATG
GAAGTGGTGCCATACCTGCCGCTGTCGAAAGAGACGCTCGCCACCATCATCGCCGGGAAACTGGCCCGCC
TGGATAACGTGCTGCGCAGCCGCTTTGGCGCGGACGTGATTATTGAGCCGGAAGTGACGGAAGAGATCAT
GAGCCGTGTCACCCGCGCGGAAAACGGCGCAAGGATGCTGGAGTCTGTCATTGACGGCGACATGCTGCCG
CCGCTCTCGCTGCTGCTGTTGCAGAAAATGGCGGCCAACACGGCGATTGCCCGCATCCGCCTGTCGGCGG
CAGACGGAGCGTTCACGGCAGATGTGGAAGATGCGCTGCCTGATGATGCCGTGACACCGCAAACAGAGGA
TGAAACGGTTTTATGA