SecReT6
Protein ID: 440288988
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3650
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3793109..3793588 [+]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDL0M6S5
KEGG IDebf:D782_3650
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.90E-30, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|440288988|ref|YP_007341753.1| type VI secretion system effector, Hcp1 family [Enterobacteriaceae bacterium strain FGI 57]
MANLIYLTLNGEMQGLISAGCSSLDSIGNKAQLTHCDQIMVMGLSHGLTRQQNVNHQMLTIIKPVDKSSP
LLGKAISENECLSCDFSFYRTSRTGMNECYYQLKLINARISSIHLHVPHTIDDSEGQPEESVEFTYESIS
WEHCTAGTSAYSLWDERVL
 
Nucleotide Sequence: 480 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3793109-3793588 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGGCAAACCTTATCTATCTTACCCTCAATGGCGAAATGCAAGGATTAATCTCAGCGGGATGTTCTTCTC
TTGATTCGATTGGTAACAAAGCACAGTTAACACACTGTGATCAAATCATGGTAATGGGGCTATCACATGG
GTTGACGCGTCAGCAGAATGTCAATCATCAGATGCTTACTATTATAAAACCCGTAGATAAGTCATCACCT
TTACTGGGCAAAGCTATTTCTGAAAACGAATGTCTTAGTTGTGACTTCAGCTTCTACCGTACAAGTCGTA
CTGGTATGAATGAATGTTATTATCAGTTAAAACTGATAAACGCCAGAATTTCCAGTATTCATCTTCATGT
TCCGCATACCATTGATGACAGCGAAGGACAACCAGAGGAATCGGTTGAATTTACATATGAATCAATTAGC
TGGGAACATTGTACTGCCGGAACAAGCGCATACAGTTTGTGGGATGAGCGGGTTTTATGA