SecReT6
Protein ID: 440288989
SecReT6 ID722
T6SS typei1
Gene symbol-
Locus tagD782_3651
StrainEnterobacteriaceae bacterium strain FGI 57
Repliconchromosome [GenBank: NC_020063] [Browse all T6SS(s) in this replicon]
Location [Strand]3793585..3794919 [+]
Producthypothetical protein
NoteTssA
UniProt IDL0M6L8
KEGG IDebf:D782_3651
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.40E-43, Aligned region: 87..150
DUF3702 [PF12486], Evalue: 1.40E-43, Aligned region: 256..267
DUF3702 [PF12486], Evalue: 1.40E-43, Aligned region: 285..429
ImpA-rel_N [PF06812], Evalue: 4.60E-21, Aligned region: 36..96
DUF4010 [PF13194], Evalue: 0.004, Aligned region: 226..250
Protein Sequence: 444 a.a.     [Download]
>gi|440288989|ref|YP_007341754.1| hypothetical protein D782_3651 [Enterobacteriaceae bacterium strain FGI 57]
MNQIISTGADPRDLPEFSAIREEINKASHPSQPDPNWKLVESLALTIFKTNGVDLHTATYYTLARSRIQG
LAGFCEGMELLAAMISHEWDKFWPQNGSARTEMLDWLNTRTGNILRQQMSFVETDLPLLYRTERALQLIC
DKLQQVELNRQPRVENLLYFVQNTRKRFEPQQKKADTSTQTTVRTLVYAPESVTSNQTEMMPPLPDLPDM
KVEVRSLAESTQPERGTKQGNMLKGFISGIISSTAVAAALWWWQVYPLQQQLSQVNDTAQGAATVWIASP
ELENYERRLQQLFDTSPIQPLETGMQMIRVADSRWPESLQQQQATAQWNETLKTRAQSSPQLRGWLQTRQ
DLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPLESLLTQYQDTRAQGQNTDTLEKQINERMDGV
LSRWLLLKNHALPKTPTADIGATK
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|440285501|ref|NC_020063.1|:3793585-3794919 Enterobacteriaceae bacterium strain FGI 57, complete genome
ATGAATCAGATCATTAGCACAGGAGCTGACCCGAGAGACCTGCCAGAATTCAGCGCCATCCGGGAGGAAA
TTAACAAGGCCAGTCATCCGTCGCAGCCAGATCCGAACTGGAAACTTGTAGAATCGCTGGCGCTGACTAT
TTTTAAGACCAATGGCGTGGATTTACATACCGCAACGTACTATACGCTGGCACGCTCACGCATACAGGGG
CTGGCTGGTTTCTGTGAAGGAATGGAGCTACTGGCTGCAATGATAAGTCATGAATGGGATAAATTCTGGC
CGCAGAATGGTTCAGCCCGTACTGAAATGCTGGACTGGCTCAATACCCGTACAGGCAATATTTTGCGCCA
GCAGATGTCTTTCGTGGAAACAGACCTGCCTTTGCTGTACCGCACCGAACGGGCATTGCAGCTTATCTGT
GACAAACTCCAGCAGGTAGAGTTGAACCGTCAACCACGCGTCGAAAATTTGCTCTATTTTGTACAAAATA
CGCGTAAGCGTTTTGAGCCACAGCAGAAGAAAGCTGATACTTCAACGCAAACTACGGTCAGAACACTGGT
TTATGCGCCGGAAAGCGTGACATCAAATCAGACCGAAATGATGCCGCCTCTGCCTGATCTGCCAGATATG
AAAGTTGAGGTACGCAGTCTGGCAGAGAGTACTCAGCCAGAAAGGGGGACAAAACAAGGCAACATGCTAA
AAGGATTTATCTCAGGTATTATCAGCTCTACGGCCGTTGCCGCTGCACTCTGGTGGTGGCAGGTATATCC
GTTGCAACAACAACTCTCGCAGGTTAATGACACCGCTCAGGGTGCCGCGACGGTGTGGATAGCCTCACCT
GAACTTGAAAACTATGAGCGCAGACTGCAACAATTATTTGATACCTCACCGATACAGCCGCTGGAAACCG
GGATGCAAATGATACGTGTTGCTGACAGCCGCTGGCCGGAAAGCCTACAACAGCAGCAGGCTACCGCACA
GTGGAATGAAACCCTGAAAACCCGCGCACAAAGCAGTCCACAATTACGTGGCTGGTTGCAGACTCGCCAG
GATCTACATGCTTTTGCTGATTTGGTGATGCAGCGTGAGAAGGAAGGACTCACGCTGTCGTATATCAAAA
ATGTTATCTGGCAGGCAGAACGAGGACTTGGCCAGGAAACTCCTCTGGAGTCCCTGCTGACGCAATATCA
AGACACTCGCGCACAGGGACAGAATACTGATACGCTGGAAAAGCAAATTAATGAGCGAATGGATGGTGTG
CTGAGCCGCTGGTTGTTACTGAAAAATCATGCATTGCCGAAAACACCAACCGCTGATATAGGAGCGACGA
AATAA