SecReT6
Protein ID: 442320129
SecReT6 ID797
T6SS typei1
Gene symbol-
Locus tagMYSTI_03152
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]3978735..3979802 [+]
ProductATP-dependent protease ATP-binding subunit ClpX
NoteTssH
UniProt IDL7U6I7
KEGG IDmsd:MYSTI_03152
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-37, Aligned region: 58..249
AAA [PF00004], Evalue: 3.70E-15, Aligned region: 62..204
ClpB_D2-small [PF10431], Evalue: 4.50E-10, Aligned region: 256..327
AAA_5 [PF07728], Evalue: 1.90E-07, Aligned region: 61..140
AAA_5 [PF07728], Evalue: 1.90E-07, Aligned region: 158..184
AAA_17 [PF13207], Evalue: 8.20E-07, Aligned region: 62..107
AAA_17 [PF13207], Evalue: 8.20E-07, Aligned region: 321..321
Mg_chelatase [PF01078], Evalue: 2.90E-06, Aligned region: 48..96
Mg_chelatase [PF01078], Evalue: 2.90E-06, Aligned region: 122..139
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 38..80
AAA_22 [PF13401], Evalue: 2.20E-05, Aligned region: 58..136
MCM [PF00493], Evalue: 2.50E-05, Aligned region: 16..140
Sigma54_activat [PF00158], Evalue: 0.00012, Aligned region: 50..82
Sigma54_activat [PF00158], Evalue: 0.00012, Aligned region: 119..141
T2SE [PF00437], Evalue: 0.00021, Aligned region: 46..84
AAA_18 [PF13238], Evalue: 0.00026, Aligned region: 62..102
AAA_33 [PF13671], Evalue: 0.00032, Aligned region: 17..46
AAA_33 [PF13671], Evalue: 0.00032, Aligned region: 62..93
AAA_33 [PF13671], Evalue: 0.00032, Aligned region: 333..348
AAA_16 [PF13191], Evalue: 0.00047, Aligned region: 50..84
AAA_16 [PF13191], Evalue: 0.00047, Aligned region: 111..141
AAA_16 [PF13191], Evalue: 0.00047, Aligned region: 256..256
AAA_14 [PF13173], Evalue: 0.0015, Aligned region: 60..137
TIP49 [PF06068], Evalue: 0.0017, Aligned region: 22..95
Sigma54_activ_2 [PF14532], Evalue: 0.0046, Aligned region: 57..138
RuvB_N [PF05496], Evalue: 0.0046, Aligned region: 20..98
Zeta_toxin [PF06414], Evalue: 0.0066, Aligned region: 57..95
ABC_tran [PF00005], Evalue: 0.0075, Aligned region: 58..157
AAA_19 [PF13245], Evalue: 0.0092, Aligned region: 59..94
AAA_19 [PF13245], Evalue: 0.0092, Aligned region: 218..229
Protein Sequence: 355 a.a.     [Download]
>gi|442320129|ref|YP_007360150.1| ATP-dependent protease ATP-binding subunit ClpX [Myxococcus stipitatus DSM 14675]
MEPSARREEAPLTPREIYERLDRYVIGQDAAKRAVAIAAHNHLKRVQARRVRRQSLIKKSNILLIGPTGS
GKTHIARNLADILHVPFTTVDATEYTEAGYYGKDVEVMISDLLLKANHSVEDTQRGIIFVDEVDKIARRS
QGARNGAGSRDIGGEGVQQGLLKLLEGREVYVPLNVTQAWNKSDFVQVDTRDILFICAGTFSDLHDAGDE
SSRPLGFGADAAARLRRRISTRQLVEFGMLAEFLGRLPVVVQLELLGEPELMRVLTEPPDSIVREFHELL
AMDDLELDFDDAALREVVHYSVSRGLGARGLRSILEHVMADVMFEAPEHRKRHLRVDADYVRARLKGLDA
VQLNV
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|442317022|ref|NC_020126.1|:3978735-3979802 Myxococcus stipitatus DSM 14675, complete genome
ATGGAGCCGTCCGCACGCAGGGAAGAAGCGCCGCTGACCCCTCGGGAAATCTATGAGCGGCTGGACCGCT
ACGTCATCGGCCAGGACGCCGCGAAGCGCGCGGTGGCCATCGCCGCCCACAACCACCTCAAGCGGGTCCA
GGCCCGCAGGGTGAGGCGGCAGTCGCTCATCAAGAAGTCCAACATCCTGCTCATCGGCCCCACCGGGAGC
GGCAAGACGCACATCGCCCGCAACCTGGCGGACATCCTCCACGTGCCGTTCACCACCGTGGACGCCACCG
AGTACACGGAGGCGGGCTACTACGGGAAGGACGTGGAGGTGATGATCTCCGACCTGCTCCTCAAGGCGAA
CCACTCCGTCGAGGACACGCAGCGGGGCATCATCTTCGTGGACGAGGTGGACAAGATTGCCCGCCGCTCG
CAGGGCGCCCGCAACGGTGCGGGCAGCCGGGACATCGGCGGGGAGGGTGTCCAGCAGGGCCTGCTCAAGC
TCCTGGAGGGGCGCGAGGTCTACGTGCCGCTCAACGTCACCCAGGCGTGGAACAAGAGCGACTTCGTGCA
GGTGGACACGCGCGACATCCTCTTCATCTGCGCGGGCACCTTCAGCGACCTGCACGACGCGGGGGACGAG
TCCAGCCGGCCGCTGGGCTTCGGCGCGGATGCCGCGGCCCGCTTGCGCAGGCGCATCAGCACCCGGCAGC
TGGTGGAGTTCGGGATGCTGGCGGAGTTCCTCGGGCGCCTGCCGGTGGTGGTGCAGCTGGAGCTCTTGGG
CGAGCCGGAGCTGATGCGCGTCCTCACGGAGCCGCCGGACTCCATCGTCCGGGAGTTTCATGAGCTGCTG
GCCATGGATGACCTGGAGCTGGACTTCGATGACGCGGCCCTCCGCGAGGTGGTGCACTACTCGGTGTCTC
GCGGGCTGGGGGCTCGCGGGCTGCGCTCCATCCTGGAGCACGTCATGGCGGATGTCATGTTCGAGGCTCC
CGAACATCGCAAGCGGCATCTTCGCGTGGACGCGGACTACGTGCGCGCGCGGCTGAAGGGGCTGGATGCC
GTGCAGCTCAACGTGTGA