SecReT6
Protein ID: 442320139
SecReT6 ID797
T6SS typei1
Gene symbol-
Locus tagMYSTI_03162
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]3993089..3994516 [-]
ProductOmpA family protein
NoteTagL
UniProt IDL7U6J4
KEGG IDmsd:MYSTI_03162
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.90E-17, Aligned region: 242..259
OmpA [PF00691], Evalue: 4.90E-17, Aligned region: 364..459
Protein Sequence: 475 a.a.     [Download]
>gi|442320139|ref|YP_007360160.1| OmpA family protein [Myxococcus stipitatus DSM 14675]
MSGGCAWWQRMGTVAALLLAQGALAQESVPLPDFVLERLEVNPGPGPLATGGGTLLRDGELRVTLLGHYQ
HEPLTINDGGETIPLLRSRSTGVLAVGLGLSSRLQLDVRVPVMTQREGESLDAQGLSAPTRTGLGSPRVG
ARVAILRTEGDDSVDLAAEVGVGLPFGTDGALARSSDTSILARVMVGGSLGSILAPSFEIGTLLRSTATI
TAENLEAREIGSELRLGAGLMTTEGPLRGEVSLNAGLSFKQAQGAVELLGGARYTPREGVELFALGGLGL
GSEPGIPLFRLVAGVSFSYLLGEDTRPDSDSSIVHESVPLPLPGSGRRPGEARGSQASLIPGPGETSPIA
NVARDRFVLEGKVYFRTASAELPAELADLDRAVEMMLTNPSVALMTVDGHTDDSRAETLNPRLGRDRAEA
VWRYLVEHGVPPNKLRLRSFGPQHPAQTNSTPEGRERNRRVELLLMLPTTQEPTP
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c3994516-3993089 Myxococcus stipitatus DSM 14675, complete genome
ATGAGTGGTGGGTGCGCCTGGTGGCAGCGGATGGGAACGGTGGCGGCCTTGCTGCTGGCTCAGGGGGCCT
TGGCCCAGGAGTCGGTGCCTTTGCCGGACTTCGTCCTGGAGCGCCTGGAGGTGAACCCGGGCCCGGGGCC
TCTCGCGACGGGAGGTGGCACCCTCCTGCGCGACGGTGAGCTCCGGGTGACGTTGCTCGGCCACTATCAA
CACGAGCCGCTGACCATCAACGACGGTGGGGAGACGATTCCCCTGTTGCGCAGCCGCTCCACGGGCGTGC
TCGCGGTGGGCCTGGGCTTGAGCTCCCGGCTACAGCTCGATGTGCGTGTGCCCGTGATGACGCAGCGCGA
AGGCGAAAGCCTGGACGCGCAGGGACTTTCGGCGCCGACACGGACCGGCCTGGGCTCGCCCCGCGTGGGG
GCGCGGGTCGCCATCTTGAGGACGGAGGGAGATGACTCGGTGGATCTCGCCGCGGAGGTCGGCGTGGGAC
TCCCCTTCGGGACGGACGGGGCGCTGGCCCGCTCATCGGATACGAGCATCCTCGCCCGGGTGATGGTGGG
TGGCAGCCTGGGCTCCATCCTGGCCCCGTCGTTCGAGATCGGCACCCTGCTGAGGTCCACGGCGACCATC
ACCGCCGAGAACCTGGAGGCGCGGGAGATCGGCTCGGAGCTCCGACTGGGCGCGGGCTTGATGACCACGG
AGGGCCCGCTCAGGGGAGAGGTCTCGCTGAACGCGGGGCTCTCCTTCAAGCAGGCGCAGGGCGCGGTGGA
GCTGCTCGGAGGCGCTCGCTATACGCCGAGGGAGGGCGTGGAGCTGTTCGCGCTGGGAGGCTTGGGGCTG
GGCTCGGAGCCCGGCATTCCCCTCTTCCGGTTGGTCGCCGGCGTGTCGTTCTCCTACCTGCTGGGCGAGG
ACACGCGGCCCGACTCGGATTCGAGCATCGTGCATGAGTCCGTGCCCCTTCCCCTGCCCGGCTCGGGACG
GCGGCCGGGTGAGGCGCGAGGGAGTCAGGCGTCGCTGATTCCGGGCCCGGGTGAGACCTCGCCCATCGCC
AACGTGGCCAGGGACCGCTTCGTGCTCGAGGGGAAGGTGTACTTCCGCACCGCCAGCGCGGAGCTGCCCG
CGGAGCTCGCGGACCTGGATCGCGCCGTGGAGATGATGCTGACGAATCCCTCGGTCGCGCTGATGACCGT
GGATGGACACACGGATGATTCGCGAGCGGAGACGCTCAACCCACGCCTGGGGCGGGACCGGGCGGAGGCG
GTATGGCGATACCTCGTGGAGCACGGGGTGCCGCCCAACAAGCTGCGGCTGCGGAGCTTCGGCCCCCAGC
ACCCCGCCCAGACCAACAGCACGCCCGAGGGCCGTGAGCGAAACCGCAGGGTCGAGCTCCTCCTCATGCT
GCCTACGACCCAGGAACCGACACCATGA