SecReT6
Protein ID: 442320145
SecReT6 ID797
T6SS typei1
Gene symbol-
Locus tagMYSTI_03168
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]4003194..4003832 [-]
Producthypothetical protein
NoteTssL
UniProt IDL7UA86
KEGG IDmsd:MYSTI_03168
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.30E-20, Aligned region: 34..207
Protein Sequence: 212 a.a.     [Download]
>gi|442320145|ref|YP_007360166.1| hypothetical protein MYSTI_03168 [Myxococcus stipitatus DSM 14675]
MKLTHWKAILLAYRHVDDTLARELGPANLDPAYRDHLSPGAMDALSRDLVVEVEKLRIALGTDLRSDDVE
KVLQPFAFLLDEKVLGRLANDDAQHWPLLQLRVFGLDSGGDLFYELADTCLRRQDTAPLLFEMLHFCLTA
GFTGRYVGHPARLREYREQLVARIPRPEAVAPQVATEEAAPPPTLYDFPWRYYAVTLAIIVALPVVLWHL
SN
 
Nucleotide Sequence: 639 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c4003832-4003194 Myxococcus stipitatus DSM 14675, complete genome
ATGAAGCTGACGCACTGGAAGGCCATCCTCCTGGCCTACCGCCATGTGGACGACACCCTGGCGCGCGAGC
TGGGCCCGGCGAACCTGGACCCGGCCTACCGCGACCACCTGTCTCCGGGCGCGATGGACGCGCTGTCGCG
CGACCTGGTCGTCGAAGTCGAGAAGCTCCGCATCGCCCTGGGCACGGACCTGCGCTCCGACGACGTGGAG
AAGGTGCTGCAGCCGTTCGCGTTCCTCCTGGACGAGAAGGTGCTCGGGCGGCTGGCGAACGACGACGCCC
AGCACTGGCCGCTCTTGCAGCTGCGCGTGTTCGGCTTGGACTCCGGCGGAGACCTCTTCTACGAGCTGGC
CGACACGTGCCTGCGCCGGCAGGACACGGCGCCCCTGCTCTTCGAGATGCTGCACTTCTGCCTCACCGCG
GGCTTCACGGGCCGGTATGTCGGCCACCCCGCGCGGCTGCGCGAGTACCGCGAGCAGCTGGTGGCGCGCA
TCCCCCGCCCGGAGGCCGTCGCGCCCCAGGTGGCGACCGAGGAAGCCGCCCCGCCGCCCACGCTGTACGA
CTTCCCCTGGCGCTACTACGCGGTGACGCTCGCCATCATCGTCGCGCTGCCCGTGGTGCTCTGGCACCTC
TCCAACTGA