SecReT6
Protein ID: 442320146
SecReT6 ID797
T6SS typei1
Gene symbol-
Locus tagMYSTI_03169
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]4003834..4005480 [-]
Producthypothetical protein
NoteTssF
UniProt IDL7U8R8
KEGG IDmsd:MYSTI_03169
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.20E-31, Aligned region: 12..340
DUF879 [PF05947], Evalue: 7.20E-31, Aligned region: 401..439
Protein Sequence: 548 a.a.     [Download]
>gi|442320146|ref|YP_007360167.1| hypothetical protein MYSTI_03169 [Myxococcus stipitatus DSM 14675]
MTRPTDRLHQDFLEEMASLERFRQRFHERYPAAPLEREDPDVRRLMEAMAFFSVQTRHATLHNLRATWRR
LFAGFFDFLLEPLPTRAVVEALPGGKMGEPILLPRGTELRLTPSQGEPGTFRLQRDLRVLPVELESTEVR
PLVRGGHRLILTFESRHERSDAVGTLSLHVRHLDEYLPSLAVFHSLRQHLRGISVVYDALADEHSTGTKC
DVSFDREAPSPEDSSSFSHPLQRLRSFFLFPETELFIHVDVAPTRGAWRRFSLCFDLAQEWTVGRSHRPD
FLVPFAVPVENLRAEPAQVITTDGTRSEHPIRNMSAGRELALHSVTGVFEMTKTGLTPLRPAHLPGSGPA
YEVEEVPTEHGPSPHLVLRMPEAFAAPRKLVVEALWHQPRFASDASGRMSVSVPGRHLEGLDWRLVGQLQ
PDRESPLRDDLTALTQLLAWKAQATLGLEELRSVLEHLGTPAEGPFRRVLPLLRELTVSRVPDSAMRGSG
LRHVYEVVVEPFEPGFEPLVVCFLTRVRDLLDSWNHEAAVELRATIAGTGPLALPGVS
 
Nucleotide Sequence: 1647 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c4005480-4003834 Myxococcus stipitatus DSM 14675, complete genome
ATGACCCGCCCCACGGACCGGCTGCACCAGGACTTCCTCGAGGAGATGGCCTCGCTGGAGCGCTTTCGCC
AGCGCTTCCATGAGCGCTACCCCGCGGCCCCGCTGGAGCGCGAGGACCCGGACGTGCGGCGCCTCATGGA
GGCGATGGCCTTCTTCTCCGTGCAGACGCGGCACGCGACGCTGCACAACCTGCGAGCCACCTGGCGGCGG
CTGTTCGCGGGCTTCTTCGACTTCCTCCTGGAGCCGCTGCCGACGCGCGCGGTGGTGGAGGCGCTCCCGG
GCGGGAAGATGGGGGAGCCCATCCTCCTGCCTCGCGGCACGGAGCTGCGGTTGACGCCCAGCCAGGGCGA
GCCCGGCACCTTCCGCCTGCAGCGCGACCTGCGCGTGCTGCCCGTGGAGCTGGAGTCCACGGAGGTGCGC
CCGCTGGTGCGCGGCGGGCACCGGCTCATCCTCACCTTCGAGTCCCGCCACGAGCGCTCGGACGCGGTGG
GAACGCTGAGCCTGCACGTGCGGCACCTGGACGAGTACCTGCCGTCGCTCGCCGTGTTCCACTCGCTGCG
CCAGCACCTGCGGGGCATCAGCGTGGTGTACGACGCGCTGGCGGACGAGCACTCCACGGGCACGAAGTGC
GACGTGTCCTTCGACCGCGAGGCCCCCTCGCCGGAGGACTCGTCGTCGTTCTCGCATCCGCTCCAGCGGC
TGCGCTCGTTCTTCCTCTTCCCGGAGACGGAGCTCTTCATCCACGTCGACGTGGCGCCCACCCGCGGGGC
GTGGCGGCGCTTCAGCCTGTGCTTCGACCTGGCCCAGGAGTGGACGGTGGGCCGCTCGCACCGGCCCGAC
TTCCTGGTGCCCTTCGCGGTGCCGGTGGAGAACCTGCGCGCGGAGCCCGCCCAGGTCATCACCACCGACG
GCACCCGCTCCGAGCACCCCATCCGCAACATGAGCGCGGGGCGGGAATTGGCGCTGCACTCGGTGACGGG
CGTGTTCGAGATGACGAAGACGGGCCTGACGCCGCTGCGGCCCGCGCACCTGCCCGGCTCGGGCCCCGCC
TACGAGGTGGAGGAGGTCCCGACGGAGCATGGCCCCTCGCCGCACCTGGTGCTGCGCATGCCGGAGGCGT
TCGCCGCGCCGCGCAAGCTGGTGGTGGAGGCGCTGTGGCACCAGCCGCGCTTCGCCTCGGATGCCTCCGG
GCGGATGTCGGTGAGCGTGCCGGGGCGGCACCTCGAGGGCCTGGACTGGCGCCTGGTCGGCCAGCTCCAG
CCGGACCGCGAGAGCCCCCTGCGCGACGACCTGACCGCGCTCACCCAGCTCCTCGCCTGGAAGGCCCAGG
CCACGCTGGGGCTGGAGGAGCTCCGCTCCGTGCTCGAGCACCTGGGCACGCCCGCGGAGGGCCCCTTCCG
CCGCGTGCTGCCGCTGCTGCGCGAGCTGACCGTGTCGCGCGTGCCGGACAGCGCCATGCGGGGCTCGGGC
TTGCGGCATGTGTACGAGGTGGTGGTGGAGCCCTTCGAGCCCGGCTTCGAGCCGCTCGTGGTGTGCTTCC
TCACGCGGGTACGGGACTTGCTGGATTCATGGAACCACGAGGCCGCAGTGGAGCTTCGCGCCACCATCGC
GGGGACCGGTCCCCTCGCCCTCCCGGGAGTCTCCTGA