SecReT6
Protein ID: 442320149
SecReT6 ID797
T6SS typei1
Gene symbol-
Locus tagMYSTI_03172
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]4007770..4008171 [-]
ProductGpw/Gp25 family protein
NoteTssE
UniProt IDL7U6K1
KEGG IDmsd:MYSTI_03172
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.30E-15, Aligned region: 27..115
Protein Sequence: 133 a.a.     [Download]
>gi|442320149|ref|YP_007360170.1| Gpw/Gp25 family protein [Myxococcus stipitatus DSM 14675]
MGRASFLDKFASRGSSVRSGSRQGGNELEHVLRNLEAVLNTKAGYGFFRRDFGLGEYTEKYGTRELVETL
TRELREEIANHEPRLSHVELTMRGRDAGLWLHFGLVGTVAGERHKLRLRFDTLSGHVRVEVEP
 
Nucleotide Sequence: 402 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c4008171-4007770 Myxococcus stipitatus DSM 14675, complete genome
ATGGGGCGCGCATCCTTCCTCGACAAGTTCGCCAGCCGCGGCAGCAGCGTCCGCTCGGGCTCGCGCCAGG
GTGGCAACGAGCTGGAGCACGTGCTGCGCAACCTGGAGGCCGTGCTCAACACCAAGGCGGGCTACGGCTT
CTTCCGCCGCGACTTCGGCCTGGGTGAGTACACGGAGAAGTACGGCACGCGCGAGCTGGTGGAGACGCTC
ACCCGCGAGCTGCGTGAAGAGATTGCGAACCACGAGCCGCGCCTGTCCCACGTGGAGCTGACGATGCGCG
GGCGCGACGCGGGCCTGTGGCTCCACTTCGGCCTGGTGGGCACCGTGGCCGGGGAGCGTCACAAGCTGCG
CCTGCGATTCGACACGCTCAGCGGACATGTCCGCGTGGAGGTGGAGCCATGA