SecReT6
Protein ID: 442320150
SecReT6 ID797
T6SS typei1
Gene symbol-
Locus tagMYSTI_03173
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]4008173..4009423 [-]
Producthypothetical protein
NoteTssK
UniProt IDL7UA89
KEGG IDmsd:MYSTI_03173
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.10E-52, Aligned region: 21..112
DUF876 [PF05936], Evalue: 6.10E-52, Aligned region: 128..413
Protein Sequence: 416 a.a.     [Download]
>gi|442320150|ref|YP_007360171.1| hypothetical protein MYSTI_03173 [Myxococcus stipitatus DSM 14675]
MPSFKLARVRWHVGQTLLPEHFEAQEAALEAEVRLHASLSGTPGFGVAAMAWSEPLLVGGSLSISTLTAV
TPAGFVVDVPGNAVLPPFSLEGTGRAEVTVYLHVMGDTTSAEGVRLYTEDPPMLERVLRRLRLSAEPVLD
GAIDTLPLALFHRDTEGLWRLAEELVPPLLLVGPHPFLGALLSRLDSLLEQARLQLIARLSDSYLRTDRL
TNARRALCEVQRLQAMRSDMLRHISPHPYSFFDALRGLYFEACCYLELMPDKHLPAYQHDAPGKGFLRWL
ELLTRALQPEATRVTHRSFEPRDGQFIFSPLPPEVLESGELYLLVQRRQAGEVLPVDGVKLAGPSRLATV
RRMALKGIPFNHVPHPSFPHALGPEIDWYQLVQGEEWQFALRENGLAFYTTPALQGAQVSLFWRRA
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c4009423-4008173 Myxococcus stipitatus DSM 14675, complete genome
ATGCCCTCATTCAAGCTCGCACGGGTCCGGTGGCACGTCGGTCAGACGCTGCTCCCGGAGCACTTCGAGG
CCCAAGAAGCGGCCCTGGAGGCCGAAGTCCGCCTCCATGCCTCGTTGTCCGGTACGCCGGGGTTCGGCGT
CGCCGCCATGGCCTGGAGCGAGCCGCTGCTGGTCGGTGGCAGCCTGTCCATCTCCACGTTGACGGCCGTG
ACACCGGCCGGCTTCGTGGTGGATGTGCCAGGCAACGCGGTGCTCCCGCCCTTCTCTCTGGAAGGGACGG
GGCGCGCCGAGGTCACCGTCTATCTGCACGTGATGGGGGATACGACGAGCGCGGAGGGCGTGCGGCTCTA
CACGGAGGACCCGCCGATGTTGGAGCGAGTCCTCCGTCGGCTGCGCCTCTCCGCGGAGCCGGTCCTGGAC
GGAGCCATCGACACGCTCCCCCTGGCCCTGTTCCATCGCGACACCGAGGGGCTCTGGAGGCTGGCGGAGG
AACTGGTTCCTCCGCTGCTCCTGGTCGGCCCCCACCCTTTCCTCGGCGCGCTCCTGTCGCGGCTGGACTC
GCTCCTGGAGCAGGCCCGGCTGCAGCTCATCGCGCGCCTGTCCGACAGCTACCTGCGCACGGACCGGCTC
ACCAACGCCCGCCGCGCGCTGTGCGAGGTGCAGCGGCTGCAAGCGATGCGCTCGGACATGCTGCGCCACA
TCTCCCCGCACCCCTACTCCTTCTTCGACGCCCTGCGCGGCCTCTACTTCGAGGCGTGCTGCTACCTGGA
GCTGATGCCGGACAAGCACCTGCCCGCGTACCAGCACGACGCTCCGGGCAAGGGTTTCCTGCGCTGGCTG
GAGCTGCTCACGCGCGCGCTCCAGCCGGAGGCCACCCGCGTCACGCACCGCTCCTTCGAGCCGCGCGACG
GCCAGTTCATCTTCTCCCCGCTGCCGCCCGAGGTGCTGGAGAGCGGAGAGCTCTACCTGCTGGTGCAGCG
CCGCCAGGCTGGGGAGGTCTTGCCGGTGGATGGCGTGAAGCTGGCGGGGCCGTCCCGGCTCGCCACCGTG
CGCCGCATGGCGCTCAAGGGCATCCCCTTCAACCACGTCCCGCACCCCTCGTTCCCTCACGCGCTGGGGC
CTGAAATCGACTGGTACCAGCTGGTGCAGGGCGAGGAGTGGCAGTTCGCGCTGAGGGAGAACGGCCTGGC
GTTCTACACCACGCCCGCGCTCCAGGGCGCCCAGGTGTCCCTCTTCTGGCGCAGGGCGTGA