SecReT6
Protein ID: 442320152
SecReT6 ID797
T6SS typei1
Gene symbol-
Locus tagMYSTI_03175
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]4010067..4011557 [-]
Producthypothetical protein
NoteTssC
UniProt IDL7UDG6
KEGG IDmsd:MYSTI_03175
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.00E-155, Aligned region: 76..495
Protein Sequence: 496 a.a.     [Download]
>gi|442320152|ref|YP_007360173.1| hypothetical protein MYSTI_03175 [Myxococcus stipitatus DSM 14675]
MAETSYLPGLFKSVRLERPSDAKPMISEKFVPALDEKEVTIEARFMSALAALVQNVPPAETDAGDAVRFD
KGKVLDVISRIDSMIDDQMNEILHHERFQQMESAWRGLEDLVSHTNFKANIAIDLLDAGRDELGQDFENN
SADVFAGSLFNKVYIQEYDQYGGRPFGAMIGLYEFSSTPGDIKWLQSMGKVANAAHCPFVAAVSPKFFGC
DKVEEMEAIKDLEGALAHPRYGKWNALRDSEEAAYLGLTFPRYVLRLPWHPDKNPCDDLHFTEDASGDSN
RYLWGNSSILFARNMVKAFEISGWCQSIRGPKGGGLITGLPVDTFFLRGQEEIKPPVEIAIPDYREYEFA
RCGFMPLVYRKGSSEATFFSTQSAKVSKRFKDPKDSENSQLVTNMAYTFSITRLAHYIKCIMRDNIGTTA
DAPYIQNQLDAWLSGYVTTVASPDDLTVRRFPFKATNVEVIQRTGEIGWYDCRVAVLPHIQFEGLNVELM
LESRLG
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c4011557-4010067 Myxococcus stipitatus DSM 14675, complete genome
ATGGCTGAAACCTCTTATCTGCCTGGGTTGTTCAAGAGCGTCCGGCTGGAGCGTCCCTCGGACGCCAAGC
CGATGATCTCCGAGAAGTTCGTCCCCGCCCTCGACGAGAAGGAAGTCACCATCGAGGCGCGCTTCATGTC
GGCGCTGGCCGCGCTCGTGCAGAACGTCCCCCCCGCGGAGACGGATGCCGGCGACGCGGTGCGCTTCGAC
AAGGGCAAGGTGCTGGACGTCATCAGCCGCATCGACTCGATGATTGACGACCAGATGAACGAAATCCTCC
ACCACGAGCGCTTCCAGCAGATGGAGTCGGCGTGGCGCGGTCTGGAGGACCTGGTCTCCCACACCAACTT
CAAGGCCAACATCGCCATCGACCTGCTGGACGCGGGCCGGGACGAGCTGGGCCAGGACTTCGAGAACAAC
TCCGCGGACGTCTTCGCGGGCTCCTTGTTCAACAAGGTCTACATCCAGGAGTACGACCAGTACGGCGGCC
GTCCCTTCGGCGCCATGATTGGCCTCTACGAGTTCTCCTCCACGCCGGGCGACATCAAGTGGCTGCAGTC
CATGGGCAAGGTGGCCAACGCCGCGCACTGCCCGTTCGTCGCCGCCGTCAGCCCCAAGTTCTTCGGCTGC
GACAAGGTCGAGGAGATGGAGGCCATCAAGGACCTGGAGGGCGCGCTCGCCCACCCGCGCTACGGCAAGT
GGAACGCCCTGCGCGACAGCGAGGAGGCCGCGTATCTGGGCCTGACCTTCCCGCGCTACGTGCTGCGCCT
GCCCTGGCATCCGGACAAGAACCCGTGTGACGACCTGCACTTCACCGAGGACGCGTCGGGCGACTCCAAC
AGGTACCTGTGGGGCAACTCGTCCATCCTCTTCGCCCGCAACATGGTGAAGGCGTTCGAGATCTCCGGCT
GGTGCCAGTCCATCCGCGGCCCCAAGGGCGGCGGCCTCATCACCGGCCTGCCCGTGGACACGTTCTTCCT
GCGCGGCCAGGAGGAGATCAAGCCGCCGGTGGAGATCGCCATCCCGGACTATCGCGAGTACGAGTTCGCG
CGCTGCGGCTTCATGCCGCTCGTGTACCGCAAGGGCTCCAGCGAGGCGACGTTCTTCAGCACCCAGTCCG
CCAAGGTCTCCAAGCGCTTCAAGGACCCGAAGGACTCGGAGAACTCGCAGCTCGTCACGAACATGGCGTA
CACGTTCTCCATCACCCGCCTGGCGCACTACATCAAGTGCATCATGCGCGACAACATCGGCACCACCGCC
GACGCGCCGTACATCCAGAACCAGCTGGACGCGTGGCTGTCCGGCTACGTCACCACGGTGGCCAGCCCGG
ATGACCTGACGGTGCGCCGCTTCCCGTTCAAGGCCACCAACGTGGAGGTCATCCAGCGCACGGGCGAAAT
CGGCTGGTACGACTGCCGCGTCGCCGTGCTGCCGCACATCCAGTTCGAGGGCCTCAACGTCGAGCTCATG
CTCGAGTCGCGGCTCGGCTAG