SecReT6
Protein ID: 442320153
SecReT6 ID797
T6SS typei1
Gene symbol-
Locus tagMYSTI_03176
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]4011598..4012200 [-]
Producthypothetical protein
NoteTssB
UniProt IDL7U9H8
KEGG IDmsd:MYSTI_03176
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.50E-38, Aligned region: 5..160
Protein Sequence: 200 a.a.     [Download]
>gi|442320153|ref|YP_007360174.1| hypothetical protein MYSTI_03176 [Myxococcus stipitatus DSM 14675]
MSIQEQLPKSRITLTYRTTINGEQETVNLPLRLLMLGDFSLGSSEDRKSDLDARKLRSVNGKNLDELMRD
MKMSLRFQVPNRINPDVEADLDVELPVDRMKSFHPDEIVNHVPKLKALRLLKKLLMEMQSSIDNQKALRN
LVYELFSNKDALKAVLAELKEYESLRLPAKPAMAANASPAANGAPATAPATVTEPATVKA
 
Nucleotide Sequence: 603 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c4012200-4011598 Myxococcus stipitatus DSM 14675, complete genome
ATGTCAATTCAGGAACAGTTGCCAAAGTCTCGCATCACGCTCACGTACCGGACCACCATCAACGGTGAGC
AGGAGACGGTGAACCTGCCGCTCCGCCTGCTGATGCTGGGGGACTTCTCGCTGGGTTCTTCGGAGGACCG
CAAGTCGGACCTCGACGCGCGCAAGCTGCGCTCCGTCAACGGCAAGAACCTGGACGAGCTGATGCGCGAC
ATGAAGATGTCGCTGCGCTTCCAGGTGCCCAACCGCATCAACCCGGATGTGGAGGCCGACCTGGACGTCG
AGCTGCCCGTCGACCGGATGAAGTCCTTCCACCCGGACGAAATCGTCAACCACGTCCCCAAGCTCAAGGC
GCTTCGGCTGCTCAAGAAGCTGCTGATGGAGATGCAGTCCAGCATCGACAACCAGAAGGCCCTGCGCAAC
CTGGTCTACGAGCTGTTCTCCAACAAGGACGCGCTCAAGGCCGTGCTCGCGGAGCTCAAGGAGTACGAGT
CGCTGCGCCTGCCCGCCAAGCCCGCCATGGCCGCCAACGCCTCGCCCGCGGCGAATGGCGCTCCGGCGAC
CGCGCCCGCCACCGTCACCGAGCCCGCCACCGTGAAGGCGTGA