SecReT6
Protein ID: 442320154
SecReT6 ID797
T6SS typei1
Gene symbol-
Locus tagMYSTI_03177
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]4012264..4013163 [-]
Producthypothetical protein
NoteTssG
UniProt IDL7U6K5
KEGG IDmsd:MYSTI_03177
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.80E-06, Aligned region: 42..118
DUF1305 [PF06996], Evalue: 4.80E-06, Aligned region: 156..198
Protein Sequence: 299 a.a.     [Download]
>gi|442320154|ref|YP_007360175.1| hypothetical protein MYSTI_03177 [Myxococcus stipitatus DSM 14675]
MTDASPRSSGSRGEPTVEERIRERAGAFDMPALVDLLAKEGYGPDDVELRSHRGTVHAPQLIHSVEFIRH
PRRAVITVNLGLLSVQSPLPSFFLKAMESLEHDAMESFLGYFDHLLLRARFAGLFPERDGSLLPGWDHAT
AHRLRLLRPSCPSTLHWLFSQAYPEAEVRVRRATRRQRIDTKGVRLGGAALGDGTAMGGFATVPTGGMEA
WLYLDESICGTGSPWAIEARRRLRSRVLPHLIDTPVFLTVALVIRDQHGHARVEDTSHLGYEPIIGGPEQ
PQQVVLFNGDTAARRPSPQ
 
Nucleotide Sequence: 900 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c4013163-4012264 Myxococcus stipitatus DSM 14675, complete genome
ATGACCGACGCCTCGCCTCGCTCCTCGGGCTCCCGGGGAGAGCCCACCGTCGAGGAGCGCATCCGCGAGC
GCGCTGGTGCCTTCGACATGCCCGCCCTGGTCGACCTGCTGGCCAAGGAGGGCTATGGCCCGGACGACGT
GGAGCTGAGGAGTCACCGGGGCACCGTGCACGCCCCGCAGCTCATCCACTCGGTGGAGTTCATCCGCCAT
CCGCGCCGCGCCGTCATCACCGTCAACCTGGGCCTGCTCAGCGTGCAGTCGCCGCTGCCGTCCTTCTTCC
TCAAGGCCATGGAGTCGCTGGAGCACGACGCCATGGAGAGCTTCCTGGGCTACTTCGACCACCTGCTCCT
GCGCGCGCGCTTCGCGGGCCTCTTCCCGGAGCGGGACGGCTCCCTGCTCCCCGGCTGGGACCACGCCACC
GCGCACCGCCTGCGCCTCCTGCGTCCGTCCTGTCCCTCCACGCTGCACTGGCTGTTCTCGCAGGCGTATC
CGGAGGCGGAGGTCCGCGTGCGCCGCGCCACCCGGCGCCAGCGCATCGACACCAAGGGCGTGCGGCTGGG
CGGCGCGGCATTGGGAGATGGCACCGCCATGGGCGGCTTCGCCACCGTCCCCACCGGTGGAATGGAAGCC
TGGCTCTACCTGGATGAGTCCATCTGCGGCACGGGCAGTCCCTGGGCCATCGAAGCGCGCCGCCGGCTGC
GCTCGCGCGTGCTGCCGCACCTCATCGACACCCCCGTGTTCCTCACCGTGGCGCTGGTGATTCGAGACCA
GCACGGCCACGCGCGCGTCGAGGACACCAGCCACCTCGGCTACGAGCCCATCATCGGCGGGCCCGAGCAA
CCGCAGCAGGTCGTCTTGTTCAACGGAGACACCGCGGCTCGCCGCCCGTCTCCGCAGTGA