SecReT6
Protein ID: 442321718
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04765
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6107913..6110534 [-]
ProductATP-dependent chaperone protein ClpB
NoteTssH
UniProt IDL7UDX8
KEGG IDmsd:MYSTI_04765
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.10E-39, Aligned region: 219..243
AAA_2 [PF07724], Evalue: 2.10E-39, Aligned region: 604..769
AAA [PF00004], Evalue: 2.90E-20, Aligned region: 221..333
AAA [PF00004], Evalue: 2.90E-20, Aligned region: 608..727
AAA_16 [PF13191], Evalue: 1.60E-15, Aligned region: 149..169
AAA_16 [PF13191], Evalue: 1.60E-15, Aligned region: 198..241
AAA_16 [PF13191], Evalue: 1.60E-15, Aligned region: 262..299
AAA_16 [PF13191], Evalue: 1.60E-15, Aligned region: 461..461
AAA_16 [PF13191], Evalue: 1.60E-15, Aligned region: 591..644
AAA_16 [PF13191], Evalue: 1.60E-15, Aligned region: 673..701
AAA_16 [PF13191], Evalue: 1.60E-15, Aligned region: 743..813
AAA_5 [PF07728], Evalue: 7.50E-12, Aligned region: 221..244
AAA_5 [PF07728], Evalue: 7.50E-12, Aligned region: 608..728
ClpB_D2-small [PF10431], Evalue: 1.70E-11, Aligned region: 777..847
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 220..302
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 606..631
AAA_25 [PF13481], Evalue: 3.30E-07, Aligned region: 221..256
AAA_25 [PF13481], Evalue: 3.30E-07, Aligned region: 462..529
AAA_25 [PF13481], Evalue: 3.30E-07, Aligned region: 606..640
Clp_N [PF02861], Evalue: 2.10E-06, Aligned region: 23..72
Clp_N [PF02861], Evalue: 2.10E-06, Aligned region: 512..526
AAA_17 [PF13207], Evalue: 3.40E-06, Aligned region: 221..260
AAA_17 [PF13207], Evalue: 3.40E-06, Aligned region: 608..643
IstB_IS21 [PF01695], Evalue: 4.10E-06, Aligned region: 207..243
IstB_IS21 [PF01695], Evalue: 4.10E-06, Aligned region: 608..627
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 218..243
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 608..630
Arch_ATPase [PF01637], Evalue: 2.10E-05, Aligned region: 199..235
Arch_ATPase [PF01637], Evalue: 2.10E-05, Aligned region: 274..368
Arch_ATPase [PF01637], Evalue: 2.10E-05, Aligned region: 608..620
NACHT [PF05729], Evalue: 3.70E-05, Aligned region: 221..249
NACHT [PF05729], Evalue: 3.70E-05, Aligned region: 608..635
AAA_18 [PF13238], Evalue: 8.10E-05, Aligned region: 221..244
AAA_18 [PF13238], Evalue: 8.10E-05, Aligned region: 610..640
MobB [PF03205], Evalue: 0.00026, Aligned region: 221..243
MobB [PF03205], Evalue: 0.00026, Aligned region: 500..520
MobB [PF03205], Evalue: 0.00026, Aligned region: 607..630
Sigma54_activat [PF00158], Evalue: 0.00029, Aligned region: 203..237
Sigma54_activat [PF00158], Evalue: 0.00029, Aligned region: 605..707
AAA_33 [PF13671], Evalue: 0.00055, Aligned region: 221..239
AAA_33 [PF13671], Evalue: 0.00055, Aligned region: 423..450
AAA_33 [PF13671], Evalue: 0.00055, Aligned region: 607..628
RNA_helicase [PF00910], Evalue: 0.00094, Aligned region: 222..242
RNA_helicase [PF00910], Evalue: 0.00094, Aligned region: 609..630
AAA_29 [PF13555], Evalue: 0.0016, Aligned region: 215..244
AAA_29 [PF13555], Evalue: 0.0016, Aligned region: 606..633
DUF258 [PF03193], Evalue: 0.0024, Aligned region: 214..239
DUF258 [PF03193], Evalue: 0.0024, Aligned region: 607..622
Zeta_toxin [PF06414], Evalue: 0.0024, Aligned region: 215..241
Zeta_toxin [PF06414], Evalue: 0.0024, Aligned region: 603..648
AAA_10 [PF12846], Evalue: 0.0035, Aligned region: 219..241
AAA_10 [PF12846], Evalue: 0.0035, Aligned region: 288..307
AAA_10 [PF12846], Evalue: 0.0035, Aligned region: 608..639
RuvB_N [PF05496], Evalue: 0.0038, Aligned region: 220..240
RuvB_N [PF05496], Evalue: 0.0038, Aligned region: 291..301
RuvB_N [PF05496], Evalue: 0.0038, Aligned region: 569..629
AAA_24 [PF13479], Evalue: 0.0046, Aligned region: 220..242
AAA_24 [PF13479], Evalue: 0.0046, Aligned region: 609..629
AAA_28 [PF13521], Evalue: 0.0048, Aligned region: 221..253
AAA_28 [PF13521], Evalue: 0.0048, Aligned region: 492..537
AAA_28 [PF13521], Evalue: 0.0048, Aligned region: 609..628
AAA_28 [PF13521], Evalue: 0.0048, Aligned region: 791..800
TIP49 [PF06068], Evalue: 0.0066, Aligned region: 221..246
TIP49 [PF06068], Evalue: 0.0066, Aligned region: 270..300
TIP49 [PF06068], Evalue: 0.0066, Aligned region: 579..644
Protein Sequence: 873 a.a.     [Download]
>gi|442321718|ref|YP_007361739.1| ATP-dependent chaperone protein ClpB [Myxococcus stipitatus DSM 14675]
MRVEPKTLVRRLTPTATRMLETAVSRASSARCYEIVPEHLLRQLLEDEEGEASLLLRHFQVDRSKVLASV
EDGLKSLRTGNSGRPVFSESLFQWFEDAWLVASLEHGVSRLRSGVLMWQWIARSERYTAESYSALDAISV
ETLKKVFEEVVGRSKEAAEVSSATAAAPSGGGGRGEEALSRFTTSFTEKARTGKIDPIFGRDREIRQVID
VLARRRKNNPIIVGEPGVGKTALVEGLARAIVAGDVPESMRNLEVLGLDLGALQAGAGVRGEFENRLKAV
ISEVKGSPKPIILFIDEAHTIIGAGGAQGGGDAANLLKPELARGELRTIAATTWAEYKKYFEKDAALERR
FQPIKVDEPSEEDAVLMLRGLCPAYAKSHGVTIRDEAVVAAVSLSHRYISGRQLPDKAVDLLDTAAARVK
IEQSARPDELVEVESRLAALERELAVRERELAAGHPVPPPEDGPTLEERLAATRDSVATVRARWEQELAA
VDVVRRARAELDAAKEGDDTSKLKADVAEARAQLEKLQGESPLIHVDVDPDVVARVVAGWTGVPVGKLRS
SSVGAVLTLEQTLRSRVKGQDAALRAVAETIRMSHAGIRNPSTPIGVLLFVGPSGVGKTETALALADTLY
GGDRFLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAVRQRPYSVVLLDECEKADLEVMNLFYQV
FDKGMLSDGEGRLIDFRNTVVILTSNLATDALMQLYSGPEAPKTETVTETIRPILSRHFKPALLARMSVV
PFIPIARDVLKDIAQMKLAALADRLHTSHRVKTEFAPEVTEEFARRCLDNDSGARNVDHLLRSSLMPRLS
MELLERLAAGGVPGRLRVGLGASGDWDLSFSDA
 
Nucleotide Sequence: 2622 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6110534-6107913 Myxococcus stipitatus DSM 14675, complete genome
ATGCGCGTTGAACCCAAGACCCTTGTTCGGCGCCTGACGCCCACGGCCACTCGGATGTTGGAGACCGCGG
TGTCTCGGGCGAGCAGCGCTCGGTGCTACGAAATCGTCCCCGAGCACCTGCTGCGGCAGTTGCTGGAGGA
TGAAGAGGGCGAGGCCTCGCTGCTCTTGCGGCACTTCCAGGTGGACCGCTCGAAGGTGCTCGCGTCCGTG
GAGGACGGGCTCAAGTCGCTGCGCACGGGCAACTCGGGGCGGCCCGTGTTCTCGGAGAGCCTGTTCCAGT
GGTTCGAGGACGCGTGGCTGGTGGCCTCGCTGGAGCACGGCGTGAGCCGGCTGCGCTCGGGCGTGCTGAT
GTGGCAGTGGATTGCGCGCTCGGAGCGCTACACCGCCGAGTCGTATTCGGCGCTGGATGCCATCTCGGTG
GAGACGCTCAAGAAGGTCTTCGAGGAGGTGGTGGGCCGCTCGAAGGAAGCCGCCGAGGTGAGCAGCGCGA
CGGCGGCGGCGCCCTCCGGCGGTGGAGGCCGAGGCGAGGAGGCGCTGTCGCGGTTCACCACGTCGTTCAC
GGAGAAGGCGCGCACGGGGAAGATCGACCCCATCTTCGGGAGAGATCGGGAGATTCGTCAGGTCATCGAT
GTGCTGGCGCGGCGCCGCAAGAACAACCCCATCATCGTGGGCGAGCCGGGCGTGGGGAAGACGGCGCTCG
TGGAGGGGTTGGCGCGCGCCATCGTCGCAGGGGATGTGCCGGAGTCCATGCGCAACCTGGAGGTGCTGGG
GTTGGACCTGGGCGCGCTCCAGGCGGGTGCGGGCGTCCGCGGCGAGTTCGAGAACCGGCTCAAGGCGGTC
ATCTCCGAGGTGAAGGGCTCGCCGAAGCCCATCATCCTGTTCATCGACGAGGCGCACACCATCATCGGCG
CGGGAGGCGCGCAGGGGGGCGGTGACGCGGCGAACCTGCTCAAGCCGGAGCTGGCGCGTGGCGAGCTGCG
GACCATCGCCGCCACCACGTGGGCCGAGTACAAGAAGTACTTCGAGAAGGACGCCGCGCTGGAGCGTCGC
TTCCAGCCCATCAAGGTGGACGAGCCTTCCGAAGAGGACGCGGTGCTGATGCTGCGTGGGTTGTGCCCCG
CCTATGCGAAGTCGCACGGCGTCACCATCCGCGACGAGGCGGTGGTCGCCGCGGTGTCGCTGTCACACCG
TTACATCTCCGGGCGGCAGCTTCCGGACAAGGCGGTGGACCTGCTCGACACGGCGGCGGCGCGGGTGAAG
ATCGAACAGAGCGCGCGTCCGGACGAGCTGGTGGAGGTGGAGTCTCGTCTGGCGGCGCTGGAGCGGGAGC
TGGCGGTGCGTGAGCGGGAGCTCGCCGCGGGGCACCCGGTTCCGCCGCCGGAGGACGGCCCGACGTTGGA
GGAGCGGCTGGCGGCGACGCGGGACTCGGTCGCGACGGTGCGCGCCCGGTGGGAGCAGGAGCTGGCCGCG
GTGGATGTCGTGCGCCGCGCGCGTGCGGAGCTCGACGCCGCGAAGGAGGGCGACGACACCTCGAAGCTGA
AGGCCGACGTCGCCGAGGCGCGCGCCCAGCTGGAGAAGCTCCAGGGCGAGTCTCCGTTGATCCACGTGGA
CGTGGACCCGGACGTGGTGGCGCGAGTGGTCGCGGGCTGGACGGGCGTGCCGGTGGGCAAGCTGCGCAGC
AGCTCCGTGGGCGCGGTGCTCACGCTGGAGCAGACGCTGCGCTCGCGCGTGAAGGGACAGGACGCGGCGC
TGCGCGCGGTGGCGGAGACCATCCGCATGTCGCATGCGGGCATCCGCAATCCATCCACGCCCATTGGCGT
GTTGCTCTTCGTGGGCCCCAGCGGCGTGGGCAAGACGGAGACGGCGCTGGCGCTGGCGGACACGCTCTAT
GGCGGGGACCGCTTCCTCACGACCATCAACATGTCGGAGTTCCAGGAGAAGCACACCGTGTCGCGCCTCA
TCGGCTCCCCGCCGGGCTACGTGGGGTACGGAGAGGGCGGTGTGTTGACGGAGGCCGTGCGCCAGCGGCC
GTACTCGGTTGTGCTGCTGGACGAGTGCGAGAAGGCGGACCTGGAGGTGATGAACCTCTTCTACCAGGTG
TTCGACAAGGGCATGTTGTCCGACGGTGAGGGGCGCCTCATCGACTTCCGCAACACGGTGGTCATCCTCA
CGAGCAACCTGGCCACGGATGCGCTGATGCAGCTGTACTCGGGCCCGGAGGCGCCCAAGACGGAGACGGT
GACCGAGACGATTCGCCCCATCCTCAGCCGGCACTTCAAGCCGGCGCTGCTGGCGCGCATGTCGGTGGTG
CCGTTCATTCCAATTGCACGCGATGTGTTGAAGGACATCGCACAGATGAAGCTGGCCGCGCTGGCGGACC
GGCTGCACACGTCGCACCGGGTCAAGACGGAGTTCGCTCCGGAGGTCACCGAGGAGTTCGCGCGGCGGTG
CCTGGACAACGACTCGGGGGCTCGCAACGTGGACCACCTGCTGCGCTCCTCGCTGATGCCGCGTCTGTCC
ATGGAGCTGCTGGAGCGCCTGGCGGCGGGAGGGGTGCCCGGGCGCCTGCGCGTGGGTCTGGGTGCGAGCG
GGGACTGGGACCTGTCATTCTCGGACGCCTAG