SecReT6
Protein ID: 442321719
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04766
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6110589..6111680 [-]
Producthypothetical protein
NoteTssG
UniProt IDL7UAX3
KEGG IDmsd:MYSTI_04766
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-71, Aligned region: 20..334
Protein Sequence: 363 a.a.     [Download]
>gi|442321719|ref|YP_007361740.1| hypothetical protein MYSTI_04766 [Myxococcus stipitatus DSM 14675]
MVSPERPTDDLLKAVESLSARPGQLSFRPLVALLERLTSSAVPVGGTGPALDERIRFRHDPSLTFSASDV
SRVRVISQPDANGGSAEVIEVVSTFLGLTGSVSPLPDYILEEIAQEDPDSARRRDFLDLFHHRLLSLLYR
ALVRYSLAAETTRGGSDAWSQRALALGGLDTYERPYSGALSPAQLLRLMPLLSARARTAGVLELALTDVL
SPVLGEATVSLRQFSGAWVDIEADNRMRLGRSNSNLSRSMLLGARVFDRSGGFSIHISPLEGDVYRRLLP
EGDLSPVVREVVDLFVRDPLDCSLVLGVREVELPRFRLSREGSFRLGQDCYLGQRRSDTRLRTRTVPLAS
APKRAEPEPLSPP
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6111680-6110589 Myxococcus stipitatus DSM 14675, complete genome
GTGGTCTCCCCGGAACGGCCGACAGACGATTTGCTGAAGGCCGTCGAGTCGCTGAGCGCCCGGCCGGGGC
AGCTGTCGTTCAGGCCGCTGGTGGCGCTGCTCGAGCGGCTGACGTCATCGGCGGTGCCCGTGGGTGGGAC
GGGGCCCGCGCTGGACGAGCGCATCCGCTTCCGGCACGACCCGTCGCTCACGTTCAGCGCGAGCGACGTG
AGCCGCGTCCGCGTCATCTCCCAGCCGGACGCGAACGGCGGGTCGGCGGAAGTCATCGAGGTGGTCTCCA
CGTTCCTGGGGCTCACGGGCTCGGTGTCGCCGCTGCCGGACTACATCCTGGAGGAGATTGCGCAGGAGGA
CCCGGACAGCGCGCGTCGGCGTGACTTCCTGGACCTCTTCCACCACCGCCTGCTCTCGCTGCTGTACCGC
GCGCTGGTGCGCTACTCGCTGGCGGCGGAGACCACGCGCGGGGGGAGTGATGCCTGGTCGCAGCGGGCGC
TCGCGCTGGGGGGGCTGGACACGTATGAGCGCCCCTATTCGGGCGCGCTGTCACCCGCGCAGCTGCTGCG
CCTGATGCCGCTGTTGTCCGCGAGGGCGCGGACGGCGGGGGTCCTCGAGCTTGCGCTGACGGACGTGTTG
TCGCCGGTGTTGGGCGAGGCGACGGTGTCGCTGCGGCAGTTCTCTGGCGCCTGGGTGGATATCGAGGCCG
ACAATCGGATGCGGCTGGGCCGCTCGAACTCGAACCTGAGCCGCTCGATGCTCCTGGGGGCTCGGGTGTT
TGATCGCTCGGGCGGGTTCAGCATCCACATCTCCCCGTTGGAGGGGGATGTCTACCGGCGCCTGCTTCCG
GAGGGAGACTTGTCGCCGGTGGTGCGCGAGGTGGTGGACCTCTTCGTGAGAGATCCGCTCGACTGTTCGC
TGGTGCTGGGCGTGCGCGAGGTGGAGCTGCCGAGGTTCCGTCTGTCGCGCGAAGGGTCCTTCCGGCTCGG
GCAGGACTGCTATCTGGGGCAGCGCAGGAGCGACACCCGCCTGCGCACGCGCACCGTGCCGCTCGCATCC
GCCCCGAAGCGGGCCGAGCCCGAGCCCCTCTCGCCGCCGTGA