SecReT6
Protein ID: 442321720
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04767
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6111644..6113386 [-]
Producthypothetical protein
NoteTssF
UniProt IDL7UEM3
KEGG IDmsd:MYSTI_04767
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.20E-182, Aligned region: 2..579
Protein Sequence: 580 a.a.     [Download]
>gi|442321720|ref|YP_007361741.1| hypothetical protein MYSTI_04767 [Myxococcus stipitatus DSM 14675]
MFSKYYQSELTYLREMGRAFGTVNPALAGLLVERGGDPDVERLLEGFAFLTARVRERIDDSVPEVVHGLT
ELLLPHYLRVIPACSVVEFTPHARLLRGRSRIPEGAEVGTKPVDGTVCTFRTTRAVDLLPLTLGETTLDQ
SSPASPVLRVQLQVVEQARAEIFQEEGLSLFLSAELPVASMLMVWLLRHCKGVVLRNPVEGESVRLGPDC
IRASGFAPDNRLLPWPSLAPEGYRLLQEYFTLPQKFLFVDVKGLQAASELTGQKLELLFEFDRPPALPGR
IPKDVFRLHCAPVVNLFSASADPVRTSALGHEHLVRAAGLEPAHMEVYSVDSVTGLQTGRTERQQYRPFF
DFAHAATDSGRFYRLHRGASPLDDGMDVSLSLGSPRDATPSLADETLSIDLTCTNRSLPSRLQVGDLSVP
TAASPTTARFRNIVAVTRPARPPVGSELHWRLLSHLSLNQRSLLEPGALQSLLALYNFQATADQSTARAN
QLRVESLRAVQAQPITRFFQGAPVRGVQVTADLEEAGFTGPGDAFLFGCVLDELFASHVSLNSFSEFVLR
LQPSRLEYRWSPRNGRQTIC
 
Nucleotide Sequence: 1743 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6113386-6111644 Myxococcus stipitatus DSM 14675, complete genome
GTGTTCAGCAAGTACTACCAGAGCGAGTTGACGTACCTCCGGGAGATGGGCCGCGCGTTCGGCACCGTCA
ATCCCGCGCTCGCCGGGCTCCTGGTGGAGCGCGGTGGTGACCCCGACGTGGAGCGGTTGCTGGAGGGCTT
CGCCTTCCTCACGGCCCGCGTCCGCGAGCGCATCGACGACTCCGTGCCGGAGGTGGTGCACGGCCTGACG
GAGCTGCTCCTCCCGCACTATCTCCGGGTGATTCCGGCCTGCTCGGTGGTGGAGTTCACGCCGCACGCGC
GCCTGTTGCGGGGCCGCTCGCGCATCCCCGAGGGCGCGGAGGTGGGCACCAAGCCGGTGGACGGCACGGT
GTGCACGTTCCGCACGACGCGCGCGGTGGACCTGCTGCCGCTGACCTTGGGCGAGACGACGCTGGACCAG
TCGTCGCCCGCGTCGCCGGTATTGCGCGTGCAACTCCAGGTGGTGGAGCAGGCGCGGGCGGAGATCTTCC
AGGAGGAAGGACTCTCGCTGTTCCTCAGCGCCGAGCTGCCAGTGGCCTCGATGCTGATGGTGTGGCTCTT
GCGCCACTGCAAGGGCGTGGTGCTGCGCAACCCGGTGGAGGGCGAGAGCGTGAGGCTGGGGCCGGACTGC
ATCCGCGCCTCGGGCTTCGCTCCCGACAACCGGCTGTTGCCCTGGCCCTCGCTGGCTCCGGAGGGCTACC
GGCTCTTGCAGGAGTACTTCACGCTGCCGCAGAAGTTCCTCTTCGTCGATGTGAAGGGGTTGCAGGCGGC
CTCGGAGCTCACGGGACAGAAGCTGGAGCTCCTCTTCGAGTTTGATCGTCCCCCCGCGCTCCCCGGGCGC
ATCCCCAAGGACGTCTTCCGGCTGCACTGCGCGCCGGTGGTGAACCTCTTCAGCGCCTCGGCGGACCCGG
TGCGCACGAGTGCGCTGGGGCACGAGCACCTGGTGCGGGCCGCGGGCCTGGAGCCGGCACACATGGAGGT
GTACTCGGTGGATTCGGTCACCGGGCTCCAGACGGGCAGGACGGAGCGGCAGCAGTACCGGCCCTTCTTC
GACTTCGCTCATGCGGCGACGGACAGTGGTCGCTTCTATCGGCTGCACCGAGGGGCGTCGCCGCTGGACG
ACGGGATGGACGTGTCGTTGTCGCTGGGCAGCCCCCGCGACGCCACGCCTTCGCTGGCGGACGAGACGCT
CTCCATCGACCTCACGTGCACCAACCGCTCGCTGCCGTCGCGCTTGCAGGTGGGGGACTTGAGTGTGCCG
ACCGCCGCGTCGCCCACCACCGCGCGCTTCCGCAACATCGTCGCGGTGACGCGTCCCGCGCGCCCGCCCG
TGGGCTCCGAGCTGCATTGGCGGCTCTTGTCGCATCTGAGCCTCAACCAGCGTTCGCTGCTGGAGCCAGG
GGCTCTCCAGTCGTTGCTGGCGCTCTACAACTTCCAGGCGACCGCGGACCAATCCACGGCGCGCGCCAAC
CAGCTCCGGGTGGAGTCGCTGCGAGCCGTCCAGGCGCAGCCCATCACGCGCTTCTTCCAAGGCGCGCCCG
TGCGCGGCGTGCAGGTGACGGCGGACCTGGAGGAGGCGGGCTTCACGGGGCCGGGGGACGCGTTCCTCTT
CGGCTGTGTCCTGGACGAGCTGTTCGCCTCGCACGTGAGCCTCAACTCCTTCAGCGAGTTCGTGCTGCGC
CTTCAACCCTCTCGACTGGAGTACCGGTGGTCTCCCCGGAACGGCCGACAGACGATTTGCTGA