SecReT6
Protein ID: 442321721
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04768
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6113416..6113862 [-]
Producthypothetical protein
NoteTssE
UniProt IDL7UDD2
KEGG IDmsd:MYSTI_04768
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.00E-17, Aligned region: 39..124
Protein Sequence: 148 a.a.     [Download]
>gi|442321721|ref|YP_007361742.1| hypothetical protein MYSTI_04768 [Myxococcus stipitatus DSM 14675]
MLPPTEGSASPGIEEGLQVTGRGLLSRIDAGKGSSERDVDMTESIVEHLRVLLNTRKGGSATVPGFGIVD
FTDFVHTFPSAIQTLQSAIRATVLEFEPRICNISVRHLPDADPLVLRFEITAQPAGRGVRGMLRFRTQMS
PGGKIEVW
 
Nucleotide Sequence: 447 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6113862-6113416 Myxococcus stipitatus DSM 14675, complete genome
GTGCTCCCGCCCACCGAGGGGAGCGCGAGCCCTGGCATCGAGGAGGGGTTGCAGGTGACGGGACGTGGTC
TGCTGTCTCGAATCGATGCGGGGAAGGGCTCGAGCGAGCGCGACGTGGACATGACCGAGTCCATCGTCGA
GCACCTGCGCGTGCTGCTCAACACGCGCAAGGGTGGGTCCGCCACGGTGCCGGGGTTTGGCATCGTGGAC
TTCACGGACTTCGTCCACACCTTCCCCTCGGCCATCCAGACGCTCCAGTCCGCCATTCGCGCGACGGTGC
TCGAGTTCGAGCCGCGCATCTGCAACATCAGCGTGCGCCACCTCCCGGACGCGGACCCGCTGGTGCTGCG
CTTTGAAATCACCGCTCAGCCCGCGGGCCGTGGGGTGAGGGGAATGCTTCGCTTCCGGACGCAGATGTCG
CCGGGAGGCAAGATCGAGGTCTGGTGA