SecReT6
Protein ID: 442321722
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04769
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6113879..6114370 [-]
Producthypothetical protein
NoteTssD
UniProt IDL7UHY2
KEGG IDmsd:MYSTI_04769
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-28, Aligned region: 9..149
Protein Sequence: 163 a.a.     [Download]
>gi|442321722|ref|YP_007361743.1| hypothetical protein MYSTI_04769 [Myxococcus stipitatus DSM 14675]
MAETVHLFLKSNASDVKGESTQTSLGREGSIECLSFEQSIITAREAGSGMATGRRQYEPLRIVKRIDKSS
PLLAKALTKNEVIDGVFKFFRPNPTGDGTTEQFYTVEIKKGRVASLKQLVPDTFIPATSQQPPLEEVTFV
FHTISWTYTNGGVTHEDSWDQNQ
 
Nucleotide Sequence: 492 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6114370-6113879 Myxococcus stipitatus DSM 14675, complete genome
ATGGCCGAGACAGTACATCTGTTCCTCAAGTCGAACGCGTCGGACGTCAAGGGTGAGAGCACGCAGACGA
GCCTCGGGCGCGAGGGCTCCATCGAGTGCCTGTCCTTCGAGCAGTCCATCATCACCGCGCGCGAGGCCGG
CAGCGGAATGGCCACCGGCCGTCGCCAGTACGAGCCGCTGCGCATCGTCAAGCGCATCGACAAGTCCTCG
CCGCTCCTGGCGAAGGCGCTGACGAAGAACGAAGTCATCGATGGCGTCTTCAAGTTCTTCCGCCCGAACC
CGACGGGCGACGGAACGACGGAGCAGTTCTACACGGTGGAGATCAAGAAGGGCCGGGTTGCCAGCCTCAA
GCAGCTCGTTCCGGACACCTTCATCCCCGCGACGTCTCAGCAGCCTCCCCTCGAGGAGGTGACGTTCGTG
TTCCACACCATCAGTTGGACGTACACCAACGGTGGTGTCACGCACGAGGACAGCTGGGACCAGAACCAGT
AA