SecReT6
Protein ID: 442321723
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04770
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6114514..6115998 [-]
Producthypothetical protein
NoteTssC
UniProt IDL7UDY3
KEGG IDmsd:MYSTI_04770
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-182, Aligned region: 66..492
Protein Sequence: 494 a.a.     [Download]
>gi|442321723|ref|YP_007361744.1| hypothetical protein MYSTI_04770 [Myxococcus stipitatus DSM 14675]
MSTEAKQLAVPEAADAAPSLLDEILSETKMKPSDDGYDVARRGVQAFIAQMLAPGRSAERVDKALVDAMI
AEVDQRLSSQVNEILHHPQLQSLESSWRSLKFLIERTDFRENTRVEVLNASKQDLITDFEDAPEVVKSGL
YRTVYSNEYGVFGGKPYGLVVGNFDVGPGPEDLSLLSKIASVAAMSHTPFVANASPEFFGQQESFLGLPA
LKDLKSLFEGPQYARWHSFRESEDARYVGLCMPRFLLRLPYSEKTVPVKSFNFTEDVVGHHERYLWGYAS
TAFASRVTDSFAKFRWCPNIIGPQAGGAVENLPLHQYEAMGEIQTKIPTEVLLTERREFELSEEGFIGLV
FRKDTDNAAFFSANSAQKPKFFGNTPEGKAAETNYRLGTQLPYMFIMSRLAHYVKVLQREQIGSWKERSD
LERELNQWINQYVADMDEPAPSVRSRRPLRTARIKVEDVEGQPGWYRCNLQVRPHFKYMGAAFTLSLVGK
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6115998-6114514 Myxococcus stipitatus DSM 14675, complete genome
ATGAGCACTGAAGCCAAGCAACTCGCGGTGCCCGAGGCGGCCGACGCCGCCCCGTCGCTCCTGGACGAAA
TCCTCTCCGAAACCAAGATGAAGCCGAGCGACGACGGCTATGACGTCGCTCGCCGAGGGGTGCAGGCCTT
CATCGCGCAGATGCTGGCACCGGGTCGTTCCGCGGAGCGCGTGGACAAGGCCTTGGTGGACGCGATGATC
GCGGAGGTGGACCAGCGCCTCAGCTCGCAGGTCAATGAAATCCTCCACCACCCGCAGCTCCAGTCCCTGG
AGTCCTCGTGGCGCTCGCTCAAGTTCCTGATTGAGCGCACGGACTTCCGCGAGAACACCCGCGTGGAGGT
GCTCAACGCCTCCAAGCAGGACCTCATCACGGACTTCGAGGATGCCCCCGAGGTCGTGAAGTCGGGCCTG
TACCGCACCGTCTACTCCAACGAGTACGGCGTCTTCGGCGGCAAGCCCTACGGCCTCGTTGTGGGCAACT
TCGACGTCGGCCCGGGCCCCGAGGACCTGTCGCTGCTGAGCAAGATCGCCTCGGTGGCGGCCATGTCCCA
TACGCCGTTCGTGGCCAATGCCTCGCCGGAGTTCTTCGGCCAGCAGGAGTCCTTCCTGGGACTGCCGGCC
CTCAAGGACCTCAAGTCCCTCTTCGAGGGTCCTCAGTACGCGCGCTGGCACTCGTTCCGCGAGAGCGAGG
ACGCGCGCTACGTCGGCCTGTGCATGCCTCGCTTCCTCCTGCGCCTGCCGTACAGCGAGAAGACGGTGCC
GGTGAAGTCGTTCAACTTCACCGAGGACGTCGTCGGCCACCACGAGCGCTACCTGTGGGGCTATGCGTCC
ACGGCGTTCGCCAGCCGGGTGACGGACTCGTTCGCCAAGTTCCGCTGGTGCCCGAACATCATCGGCCCGC
AGGCGGGTGGCGCGGTGGAGAACCTGCCGCTGCACCAGTACGAGGCCATGGGGGAGATCCAGACGAAGAT
CCCCACCGAGGTGCTCCTCACCGAGCGCCGCGAGTTCGAGCTGTCCGAGGAGGGCTTCATCGGCCTGGTG
TTCCGCAAGGACACGGACAACGCGGCCTTCTTCTCCGCCAACTCGGCGCAGAAGCCCAAGTTCTTCGGCA
ACACGCCGGAGGGCAAGGCGGCCGAGACGAACTACCGGCTGGGCACCCAGCTTCCGTACATGTTCATCAT
GTCCCGCCTGGCGCACTACGTGAAGGTGCTCCAGCGCGAGCAGATTGGAAGCTGGAAGGAGCGCTCGGAC
CTGGAGCGCGAGCTGAACCAGTGGATCAACCAGTACGTCGCGGACATGGACGAGCCGGCGCCCAGCGTGC
GCTCGCGCCGTCCGCTCCGCACCGCCCGCATCAAGGTGGAGGACGTGGAGGGGCAGCCCGGCTGGTACCG
CTGCAACCTCCAGGTGCGCCCTCACTTCAAGTACATGGGCGCCGCTTTCACACTCTCGCTCGTTGGCAAG
CTGGACAAGGAATGA