SecReT6
Protein ID: 442321724
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04771
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6116038..6116532 [-]
Producthypothetical protein
NoteTssB
UniProt IDL7UAX6
KEGG IDmsd:MYSTI_04771
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-57, Aligned region: 5..158
Protein Sequence: 164 a.a.     [Download]
>gi|442321724|ref|YP_007361745.1| hypothetical protein MYSTI_04771 [Myxococcus stipitatus DSM 14675] [TssB]
MSKEGSVAPKERVNIVYKSDTGNAQSEVELPLKVLVVGDFTGRQDERPVEERAPINIDKNNFNEVMAKQG
LSLDASVPNKLSDDPDASMSVALKFQNLSDFTPEGIVNQVPELRQLLELRAALNALKGPLGNVPAFRKKI
QTLLGDSEGRQKLMAELGLDKKAD
 
Nucleotide Sequence: 495 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6116532-6116038 Myxococcus stipitatus DSM 14675, complete sequence [TssB]
GTGAGCAAGGAAGGTTCTGTGGCGCCCAAGGAGCGCGTCAACATTGTCTATAAGTCGGACACTGGAAACG
CGCAGTCGGAAGTCGAGCTGCCCCTCAAGGTTCTCGTGGTGGGAGACTTCACGGGCCGCCAGGACGAGCG
TCCCGTCGAGGAGCGGGCGCCCATCAACATCGACAAGAACAACTTCAATGAAGTGATGGCCAAGCAGGGG
CTGTCGTTGGACGCCAGCGTCCCCAACAAGCTCTCCGACGACCCGGACGCGAGCATGTCCGTGGCGCTGA
AGTTCCAGAACCTGTCGGACTTCACCCCGGAGGGCATTGTCAACCAGGTTCCGGAGCTGCGTCAGCTCCT
GGAGCTGCGCGCGGCGCTCAACGCCCTCAAGGGCCCCCTGGGCAACGTGCCGGCCTTCCGCAAGAAGATC
CAGACGTTGCTCGGCGACTCCGAGGGACGTCAGAAGCTCATGGCGGAATTGGGGCTGGACAAGAAAGCCG
ACTAG