SecReT6
Protein ID: 442321725
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04772
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6116559..6118211 [-]
Producthypothetical protein
NoteTssA
UniProt IDL7UEM7
KEGG IDmsd:MYSTI_04772
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.70E-20, Aligned region: 54..114
Protein Sequence: 550 a.a.     [Download]
>gi|442321725|ref|YP_007361746.1| hypothetical protein MYSTI_04772 [Myxococcus stipitatus DSM 14675]
MAVTLEQLKEQAKQWIEPVSADAPAGKAAKADPAYLEVLAEMAKLESVTGGTIDWNQVQSSSGKVLQSTS
KDLRIATYLAHCLYQTQGIDGLATGLVVVSEILDRYWPTLFPELARMRGRSNVMTWLVERTAAHLPSLQV
TASDRPRVEALEVAAKRLSEVSKQKFEANGPAMRPLMESVQRLMASLPAEAPPPPPAPVAAAAPAAPKPA
PAPVAAPPPPPVAAATAPAPAPIPAQAMPAVGSLASADAAVDFLRQTGTALVSAAGVVRGASPVDPLSYR
LLRIGLYLHLAQPPPADASGKTSIPVPPENLRANLERMAANARWAPLLEESEGTLTQHRFFLDLHYLSAK
ALGELGHTAARQALVAELASWLKRMPTVPGLLFGDGTPVASPETRAWLESVVAPPVSPSAPPSFSGAETE
KGDTAAEVLAEARKLVSGGNAAGAVNLLQEQVGAAGTGRKRFQARLTLAKLCAAAGQTHVARALYEVLDR
ESLERGLDTWEPKLSAECLEGWLALSRPPPKSPEALVSDFTARYHRLCLLEPSAALKVAP
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6118211-6116559 Myxococcus stipitatus DSM 14675, complete genome
ATGGCGGTGACGCTGGAGCAGTTGAAGGAACAGGCGAAGCAGTGGATCGAGCCCGTGTCGGCGGACGCAC
CCGCGGGCAAGGCGGCCAAGGCCGACCCCGCCTATCTGGAAGTGCTGGCCGAGATGGCCAAGCTCGAGTC
CGTCACCGGTGGGACCATCGACTGGAACCAGGTCCAGAGCTCCAGCGGCAAGGTGCTCCAGTCCACGTCG
AAGGACCTGCGCATCGCCACCTATCTGGCGCACTGCCTCTACCAGACGCAGGGCATCGACGGGCTCGCGA
CCGGCCTCGTGGTCGTCTCCGAGATCCTGGACCGCTACTGGCCCACGCTCTTCCCCGAGCTGGCGCGCAT
GCGGGGTCGCTCCAACGTGATGACGTGGCTGGTGGAGCGCACCGCGGCCCATCTCCCGTCGCTGCAAGTC
ACTGCGAGCGACCGCCCGCGAGTGGAGGCACTCGAGGTCGCCGCCAAGCGCCTGTCGGAGGTGTCGAAGC
AGAAGTTCGAGGCCAATGGGCCCGCGATGCGGCCGTTGATGGAGAGCGTCCAGCGGCTGATGGCCTCGCT
GCCGGCGGAGGCACCTCCTCCGCCTCCCGCGCCCGTGGCCGCCGCTGCTCCCGCCGCGCCCAAGCCCGCA
CCGGCGCCTGTCGCCGCGCCACCGCCTCCTCCGGTGGCCGCCGCGACGGCGCCCGCGCCCGCGCCCATCC
CCGCGCAGGCCATGCCCGCGGTGGGCTCCTTGGCGAGCGCGGACGCGGCGGTCGACTTCCTCCGGCAGAC
GGGCACCGCGCTGGTCAGCGCCGCCGGAGTGGTTCGCGGTGCGTCGCCCGTGGACCCGCTGTCCTACCGG
CTGCTGCGCATCGGGCTCTATCTCCACCTGGCCCAACCTCCGCCGGCGGATGCCAGTGGCAAGACGAGCA
TCCCCGTGCCGCCGGAGAACCTGCGTGCGAACCTGGAGCGCATGGCGGCCAACGCCCGCTGGGCACCGCT
GCTGGAGGAGTCCGAGGGGACCCTCACCCAGCATCGCTTCTTCCTGGACCTGCACTACCTGAGCGCGAAG
GCGTTGGGGGAGCTGGGGCACACCGCGGCACGTCAGGCATTGGTGGCGGAGCTCGCCTCCTGGCTGAAGC
GGATGCCCACGGTGCCAGGACTTCTCTTCGGCGACGGCACCCCCGTCGCCTCACCCGAGACGCGCGCCTG
GCTGGAGTCCGTCGTCGCGCCGCCGGTGTCGCCTTCCGCGCCACCCTCTTTCTCAGGGGCAGAGACAGAA
AAGGGAGACACCGCGGCGGAGGTCCTCGCCGAGGCGCGCAAGCTGGTGTCAGGCGGCAACGCTGCGGGCG
CGGTGAACCTTCTCCAGGAGCAGGTGGGTGCTGCGGGCACGGGTCGAAAGCGATTCCAGGCCCGACTCAC
CCTCGCGAAGCTCTGCGCCGCGGCGGGCCAGACCCACGTGGCGCGTGCCCTCTACGAGGTCCTCGACCGC
GAGTCGTTGGAGCGCGGGCTGGATACGTGGGAACCGAAGCTGTCGGCGGAGTGTCTGGAAGGATGGCTTG
CCCTCTCACGTCCTCCGCCAAAGTCACCCGAGGCGCTGGTGTCTGACTTCACCGCCCGTTATCATCGGCT
CTGTCTGCTTGAGCCGAGTGCCGCGCTGAAGGTGGCGCCCTAA